6O58


Conserved Protein Domain Family
MCU

?
pfam04678: MCU 
Mitochondrial calcium uniporter
MCU functions with MICU1, an essential gatekeeper component of calcium-channel transport, to facilitate Ca2+ uptake into the mitochondrion.
Statistics
?
PSSM-Id: 398382
Aligned: 87 rows
Threshold Bit Score: 118.104
Threshold Setting Gi: 339898645
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6O58_A       118 EDRGIDRVAIYSPDGVRVAASTgidllllddfklvindltyhvrppkrdllshEnAATLNDVKTLVQQLYTTL------- 190
XP_018468504 101 PDEARVFARVLDDAGVVLIFRD----------------------------------KVYLHPDKVVDLIRRAMpl----- 141 radish
KQK10314     107 RAEATALAGALDEAGVVLLFRD----------------------------------KVYLQPDKIVDLVRKAMpl----- 147 stiff brome
XP_004980118  98 HAEAEELARAMDDAGVVLLFRD----------------------------------KAYLHPEKVVDLVRRAVpl----- 138 foxtail millet
XP_001419914 173 AEETAIKVKLLEECGAVLILED----------------------------------MVYLHPRDVTSAVLRVL------- 211 Ostreococcus lu...
XP_002503501   9 DEAQDETLATLQKAGVIIKLDD----------------------------------VVYTNPGQLTRDVLAVL------- 47  Micromonas commoda
XP_003392651 111 VEDPDAALADLEAAGVVVVLDG-------------------------------G-SMVHLRPVLYLETLEMICnvarpss 158 Leishmania infa...
Q387B7       112 VEDTDKALQLLCESGVVVSISD-------------------------------G-AAVHLRPVQFLQMHNDAAdasdak- 158 Trypanosoma brucei
Q4CZP7       108 VENSDEALRLLEESGSVVSLSN-------------------------------G-EGVHLRPLQFAHMYEDLTgegeek- 154 Trypanosoma cruzi
CAM38980      48 DAEAVKYIDTLKRAKMVVVVED----------------------------------YVYTDVKAVIDAVHLKSglp---- 89  Leishmania braz...
6O58_A       191 ------------------CIEQHQLNKERELIERLEDLKEQLAPLEKVRIEISRKAEKRTTLVLWGGLAYMATQFGILAR 252
XP_018468504 142 -----------------eETP-----------EEDQI-KEEFNKLRTMKEEIDVLAHRQVRRILWGGLATAVVQIGLFVR 192 radish
KQK10314     148 -----------------aLTP-----------EDDPR-KEELKQLQTKLEDINKLAHKQVRRILWSGLGFLITQVGLFFR 198 stiff brome
XP_004980118 139 -----------------aLGP-----------ENDPR-KKEFKQLQEKKEEIDKLAHKQVRRILWSGLGFFMCQVGLFFR 189 foxtail millet
XP_001419914 212 --------------------PGVPSKVYGITDADLQAMTNEFETMKENYKVARRRAEARSRTIISSGLIVLCLQLATFVR 271 Ostreococcus lu...
XP_002503501  48 --------------------PRVPSYVYGVSDAELVSLEADLAAQEAEVTAAAERARWRSNVVVGSGLALMCTQLVVFMR 107 Micromonas commoda
XP_003392651 159 sgnetsetnskpsvavrsFMVEEAERRVATLTEREKAMRNRLQPAIA-------RAARWRRTVWGAALLYAGAQLAIISR 231 Leishmania infa...
Q387B7       159 ------------vktpfeDYIRAAQNRLADAEAEEMAMRVALQPAID-------NAAKRRRLLWSGALCLMAVQLAVISR 219 Trypanosoma brucei
Q4CZP7       155 -------------gstlaFFLEEATKRLKAAQAEEAAMRSELQPALM-------RAAKWRRVVWGGALCFSGAQMAIISR 214 Trypanosoma cruzi
CAM38980      90 ---------------lvpSTSKGFMCFHHMMSESLAAFNRECSLAME-------RAVRREKEFWAFTALVSGIQMLVLAY 147 Leishmania braz...
6O58_A       253 LTWWEYSWDIMEPVTYFITYGSAMAMYAYFVMTRQEYVYPEARDRQYLLFFHKGAKKSRFDLEKYNQL 320
XP_018468504 193 LTFWEFSWDVMEPITFFVTATSIIVGYAYFLITSRDPTYQDFMKRLFLSRQRKLLKSQHFDVERFKEL 260 radish
KQK10314     199 LTFWEFSWDVMEPITFFTTTTGLVVGYAYFLITSRDPTYRDFMERLFQSRQRKLIQRQNFNLERYLEL 266 stiff brome
XP_004980118 190 LTFWEFSWDVMEPIAFFTTASGLLVGYAYFLVTSRDPTYQDFMERLFLSRQRKLCAAQKFDMERYMEL 257 foxtail millet
XP_001419914 272 LTYYEFSWDVMEPLSYFVGLCNAILVYVYYLWNRRDFSFETWQNSLAGKYADSHLRRSGFDLDRYVAL 339 Ostreococcus lucimarinus CC...
XP_002503501 108 LTYVELSWDVMEPISYFVGVFNAILVYIYFMVYKRDFSFNDWTSRMQTSYTKSAVSKKGIDWERYKKI 175 Micromonas commoda
XP_003392651 232 LTYFDLDWDIMEPVSYMITVANTLFFFLYYLRFNEEHSYTAFDQRFLPRKV-RQYAPRDFDWAAYADV 298 Leishmania infantum JPCM5
Q387B7       220 LTFVDLDWDIMEPVSYFLGSGTSILFLIYLLRNGRVKSYKEYEEKAAASRV-RLHAPADFEWRKYDAV 286 Trypanosoma brucei
Q4CZP7       215 LTFFDFDWDTMEPVSYFLGTGTSLLFFLYFLRHGRSHTYEDYDRTTLPKKL-RKYAPPGFDWEKYEAI 281 Trypanosoma cruzi
CAM38980     148 LTFQVYGWDVMEPVTFFVTTATALCSYAYFLCFRTEHSYESVDDNFLPHLLMKELSALRVDANKvihd 215 Leishmania braziliensis MHO...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap