2HIX,3GDE


Conserved Protein Domain Family
DNA_ligase_A_N

?
pfam04675: DNA_ligase_A_N 
Click on image for an interactive view with Cn3D
DNA ligase N-terminus
This region is found in many but not all ATP-dependent DNA ligase enzymes (EC:6.5.1.1). It is thought to be involved in DNA binding and in catalysis. In human DNA ligase I, and in Saccharomyces cerevisiae, this region was necessary for catalysis, and separated from the amino terminus by targeting elements. In vaccinia virus this region was not essential for catalysis, but deletion decreases the affinity for nicked DNA and decreased the rate of strand joining at a step subsequent to enzyme-adenylate formation.
Statistics
?
PSSM-Id: 398380
Aligned: 418 rows
Threshold Bit Score: 48.7177
Threshold Setting Gi: 347947826
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2HIX_A         22 EFKVIAEYFDKLEK--I-SsrlQLTALLADLLsksD---------KtiIDKVVYIiqgkLWPDFlGYpELGIGEKFLIKA 89   Saccharolobus...
EDX13219       12 klDTFRRICDEIAGesSyL---KKAEKLQRFFe-kGssgk-gfkgD--TLLWVQF----LIPAAnQR-VYNLQNKALIKL 79   Drosophila si...
EGT55659      162 SFYKFVKVCAVLKDtsNnT---EKSAVITSLLq-kKgf-----dgD--LKLWLTF----LIRESdER-VYNVTDEQLIKN 225  Caenorhabditi...
XP_002646686  162 SFYKFLKVCSVMKDisSsS---EKSAVITSMLq-kKgf-----dgD--LMLWLSF----LIRESdKR-DYNVTDEKLVSY 225  Caenorhabditi...
EFC36977       16 RFSEFVALCKDIEEvsAhT---EKSQVMKEF----Lsdf----kgD--VYLLYKL----LFAKEnQR-KFNLKDKKLVDV 77   Naegleria gru...
EGC32964        8 slySLSKLCEKLKEesThS---GKTQIISSF----Ckvf----ngD--LYLLAKL----LLCKEdKR-VFRMRDKVMLKI 69   Dictyostelium...
EFA78161        7 sFFSFYKLCKELENesShT---GKSKIVALF----Vdkf----dgD--LYLLAKL----LLVKEdKR-VFRIKDKQMVKI 68   Heterostelium...
XP_004359061   47 slkSMTGLCSVLEKesAhS---GKMEVIQAF----Ceef----kgD--LYLLAKL----FLVKEdKR-VFRIKDKQMVKI 108  Cavenderia fa...
EGD81001      332 TFANFCDLCNRIAArpSyN---DKTDAVRQYIt-kGnsagdgfkgD--LYLVIRL----LLPRNpKR-VYNMKDKAFVRV 400  Salpingoeca r...
XP_001745548  225 SFAAFQELCRDIEAhpGhT---DKGNIIRTFIt-kGtsgq-gftgD--LYLVMRH----LLPQHpKR-VYNMKEKQLVKI 292  Monosiga brev...
2HIX_A         90 ISIATNTDENsvenlyktIGDLGEVARRLKs---KQqstgilgflgttsKESLTVDEVYSTLSKVAlttGEGSRdlkIRL 166  Saccharolobus...
EDX13219       80 FSRIFNADQQqmhldleqDGDVSETLRKHFa---ASkklk------pqaQSKLYLQEVEEMLLKLV---ERTKEdeqTDL 147  Drosophila si...
EGT55659      226 FARILDTDEAkiqkyvdkSGDVALSISHAHe---KKvt---------neKGKWSIQKVDRYLDKLS---KLEGEdevLNH 290  Caenorhabditi...
XP_002646686  226 FVKILDTDEAkilkyiskSNDVALSIAHAHe---KKvt---------neKSNWSLQKVDRFLEKLE---TLKEDdeiVKH 290  Caenorhabditi...
EFC36977       78 CASAFGEDLDemidhmdsKGDVSETLKKYLv---RSdha--------rdKGIVTLKQVDDFLEELT---QLSKKedqIRA 143  Naegleria gru...
EGC32964       70 CAHIWDADLDdmia-dldnGDFTETCKKFYieygKYp-----------eKSTLTLKQVDDFLDSLT---LSGKFdeqVKI 134  Dictyostelium...
EFA78161       69 LAEVWNEDLDemia-dldkGDVTETAYKFYq---RQeni--------ptKSTLTLGQVDEFLDVLT---TISKFddqVKA 133  Heterostelium...
XP_004359061  109 LAEIWDADLDdmta-dldkGDVTETAKKFMi---KSgkf--------adQSTYTLKQVDEFLDKLT---TVSKFddqVVV 173  Cavenderia fa...
EGD81001      401 FSNLLGCDAAamta-dldkGDCPETCATFFa---KNkrip------pkeKSTLTLAEVENFLRRME---GLTTIdaqTAE 467  Salpingoeca r...
XP_001745548  293 FSALFHTSEQdlte-hleqGDVSDTMASFFa---TSqglr------paaQSTLSLEDVENLLRQLE---NRTTIdeqTRV 359  Monosiga brev...
2HIX_A        167 LAGLLKK-ADPLEAKFLVRFVEGRLRVGIGDATV 199  Saccharolobus solfataricus
EDX13219      148 LQKLCSK-ATDLDLRTFIRLVKHDLRINARARHI 180  Drosophila simulans
EGT55659      291 LKFAAKR-MRHDELDVLIRLIRKELDTEASTATI 323  Caenorhabditis brenneri
XP_002646686  291 LKFAAKR-FRHDELEVLIRLIRKELDTGATATVV 323  Caenorhabditis briggsae
EFC36977      144 FKKFVNDkLTGDELKFICRIICKDLKIRAGPKYL 177  Naegleria gruberi
EGC32964      135 ISSLLKK-CTPQDFRLICRIIDSDLKINTGAKFF 167  Dictyostelium purpureum
EFA78161      134 ISKFLKK-CTAFDWRLVNRIIDSDLKINMGAKYF 166  Heterostelium album PN500
XP_004359061  174 IKKFLKH-CTPNDWRLVNRMIDSDLKVNTGAKFF 206  Cavenderia fasciculata
EGD81001      468 FRKLLPK-CTVNDVRFILRSMKHDLRTFAGPKHI 500  Salpingoeca rosetta
XP_001745548  360 FRQHLPR-MTTEDLRYVVRHIKHDLRIFAGSKII 392  Monosiga brevicollis MX1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap