Conserved Protein Domain Family
Cyclase_polyket

?
pfam04673: Cyclase_polyket 
Polyketide synthesis cyclase
This family represents a number of cyclases involved in polyketide synthesis in a number of actinobacterial species.
Statistics
?
PSSM-Id: 398378
Aligned: 39 rows
Threshold Bit Score: 118.086
Threshold Setting Gi: 499292564
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Cfla_3338    3 HRLLIVARMDPGAWSDVAGLFAESDASDLPHDLGVVRRDLYAYQGLYFHHVEFAGS-PDAAMARARD--RADFRRLSADL 79  Cellulomonas ...
Q47QL4           2 HSTLIVGRMRPEDQDDVARLFAAFDATEMPHLMGTLRRELFTYRGLYFHLQNFATPdGAANIAKARS--HPLFQQISNDL 79  Thermobifida ...
BAC70095       119 YSAVIVNTQRQEHIPEAARLFAESDATDIPQKMGTLRRQIYLWRGIYLHIQDFAVAnSMEAISEVWTegDPRFLQLVDDL 198 Streptomyces ...
WP_011906074     2 YSTLIVGRMQPQWSTEVAELFGAFDDTEMPHRMGTRRRELFHYQGLYFHLQDFDGEyGGDRIAQART--DPRFIRISADL 79  Salinispora t...
jgi:SACTE_6345   2 HSSLIVARMDGASQHEVARLFGEFDRTEMPHLMGTRRRQLFAYRGLYFHLQDFDTDdGGRLIEEART--DPRFVRISDDL 79  Streptomyces ...
Q9XCV6           2 HSTLIVARMEPGSSTDVAKLFAEFDASEMPHLMGTRRRQLFSYRGLYFHLQDFDADnGGELIERAKT--DPRFVGISEDL 79  Streptomyces ...
CCH32744         2 FSTLIVARMDPGSSPDVAELFAHFDTTEMPHLMGTRRRQLFSYRGLYFHLQDFETEhGHESIEAVRT--EPRFVRISDEL 79  Saccharothrix...
jgi:Caci_3545    2 HSTLIVARMDPGSAGDVAKLFGEFDSTDMPGRMGTRRRELFTYRGLYFHLQDFDHEhGGEDIEAAKT--DPQFVRISADL 79  Catenulispora...
WP_013734504     2 DRTLIVAKVVPTAENAVAEIFAESDTTELPHLVGVAHRSLYRLHDLYVHLLETDTP-GDGAVEAARD--HPEFRRISARL 78  Verrucosispora
WP_012013733     2 ERSLIVAKVDPSAEERIAEIFAESDATELPRLAGVQHRSLYRLQDLYLHLLETELP-GENAVAEARC--HPEFIRVSERL 78  Salinispora t...
jgi:Cfla_3338   80 EPYVRPYDPAtWRSPADATATPFYRWT 106 Cellulomonas flavigena DSM 20109
Q47QL4          80 RPFITAYDPDtWRSPADAVATRFYHWS 106 Thermobifida fusca YX
BAC70095       199 TEIIPPYDPQ-----GNSLATRFYHWA 220 Streptomyces avermitilis MA-4680 = NBRC 14893
WP_011906074    80 KPFIRPYDPAtWRSPTDALATRFYHWA 106 Salinispora tropica
jgi:SACTE_6345  80 KPFVEAYDPAtWRSPADALAQRFYAWg 106 Streptomyces sp. SirexAA-E
Q9XCV6          80 KPFIEAYDPAtWRSPADAMATRFYNWE 106 Streptomyces venezuelae
CCH32744        80 KPFIEAYDPRtWRSPADAMASRFYHWE 106 Saccharothrix espanaensis DSM 44229
jgi:Caci_3545   80 KPFIEAYDPAtWKSPADAMASRFYRWS 106 Catenulispora acidiphila DSM 44928
WP_013734504    79 RPYITPYLPD-WRSPRDAMARCFYRFD 104 Verrucosispora
WP_012013733    79 RPYVSPYLPT-WREPRDAMARCVYRFD 104 Salinispora tropica
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap