Conserved Protein Domain Family
Phenol_monoox

?
pfam04663: Phenol_monoox 
Phenol hydroxylase conserved region
Under aerobic conditions, phenol is usually hydroxylated to catechol and degraded via the meta or ortho pathways. Two types of phenol hydroxylase are known: one is a multi-component enzyme the other is a single-component monooxygenase. This region is found in both types of enzymes.
Statistics
?
PSSM-Id: 398372
Aligned: 15 rows
Threshold Bit Score: 91.6475
Threshold Setting Gi: 361054951
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011766170           14 ADAIEKFHGAQLLYIGWEDHLLFCAPFAFPFPPTMPFGAIVEQVLPGSFGYHPDFARIDWEKAEWF 79  Azoarcus sp. BH72
Q479F9                 14 ADTQDKFHGNQLLFVGWDDHFLFVAPLAFSVSPNTKFSDLVEKNLTFAYGRHSDWAKVDFSKAVWL 79  Dechloromonas aromat...
ACR01709               14 ADTQDKFHGAQLLYIGWEDHLLFCAPFAFPFPSTMRFGDVVARPMQAAFGYHPDFAQIDWAKAEWL 79  Thauera sp. MZ1T
CDM23342               14 KDRLENFHGNQLTYIGWEDHLLFCAPFCFPFPPDMPFGLIIDQVLPGAFGYHPDFARIDWSKVEWF 79  Castellaniella defra...
WP_016490634           14 LDRQENFNGLQLVYLTWDRHLMFCAPFTLPLPPDMPFADFIDNVVKPAIAAHPDAVRVDFAQAIWr 79  Pseudomonas resinovo...
WP_008643948           15 RDRIENFHGNQLVYFGWDQHRLFCSPFTLPLPPDMPFGALVSDVIVPLLGAHPEGARIDWAQVQWL 80  Cupriavidus
calssnu:BYI23_C000530  10 RDRIENFHGKQLLFVGWEDHLMFCAPHCIPVEASTPFRTLVDDMLPAMYAAHPDWSSVQLNAAEWF 75  Burkholderia sp. YI23
CAL94466               14 RDQVANFHGKQLVYVSWDRHLLFAAPFLICLPPETPFRELVEGPLKALVSPDPDAAAIDWQRVEWL 79  Azoarcus sp. BH72
BAI96036               14 ADKAENFHGACVIYAGWDGHLLFSSPYAWPLPPDLPFAHFIAGPMAEIFGQHPDWAGIDWNSAVWT 79  Sphingobium japonicu...
DSC:DSC_04420          14 KDVQENFPA-PLLFIGWEDHLMFGTPVALPLPPDTPFGALCTAVLPGTYGYHPDFARIDWAKVEWF 78  Pseudoxanthomonas sp...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap