Conserved Protein Domain Family
FUSC

?
pfam04632: FUSC 
Fusaric acid resistance protein family
This family includes a conserved region found in two proteins associated with fusaric acid resistance, FusC from Burkholderia cepacia and fdt-2 from Klebsiella oxytoca. These proteins are likely to be membrane transporter proteins.
Statistics
?
PSSM-Id: 398356
Aligned: 63 rows
Threshold Bit Score: 200.199
Threshold Setting Gi: 122375347
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q63MA6         39 WLHLAKTVAAALLAMGIAMLLDLSQPRIAMTTVFVLMQPMSGMVLAKSFYRVVGTGVGLVAALALGGLFAQQPELYMAGI 118 Burkholderia p...
Q5FSY9         14 LQFSLRTWFALVLALGTAFWSQLDSPASAGVTVMILAQPLRGQALSKAFYRLAGTVLGVSVSIILVAMFNEERALSLGGA 93  Gluconobacter ...
O05543         41 AGYALRTTCTSLLALGIALWMELGSPQWAALTVWMVAQGTRGRSLAKAKWHLFGMVVGVISGITLVAAIPQAPLMFILLL 120 Gluconobacter ...
Q5FUL5         42 VTFALRNTIAACLAVGIAFWMELDDPAWAAMTVWAVAQTSRGESQSKAKWRIVGTISGAIAAITIMAAAPQAPWMFFPMI 121 Gluconobacter ...
Q5FT35         34 LGFSIRTTIAALVALAIALWMELGQPQWAPMTVWIVAQGTLGESLSKARWRVAGTLGGIVSAIALASAFPQAPWLFFPAL 113 Gluconobacter ...
jgi:Pden_0233  25 RATALRLTLAAMIAMVVATGLGLQNPWWAAMATWMIGQPPRGLLLERSVAQFAGTLLGAAAGVAIT--LAGNPSLQLAWL 102 Paracoccus den...
jgi:Daci_5715  25 LRQHLRTAFAACLALLAAWQLGLEHPQWAAMATWAASQPLRGQLLEKSFFRVAGTVAGTAVGVGLVLLAQGNLLWLVLGL 104 Delftia acidov...
WP_012113326   17 LNFTLRTALAACCALLVAWLVGLEHPQWSAMTVWAAAQPVRGQLVEKSFFRALGTIIGSVAGIGLLFAAHGQQWAIVLGL 96  Xanthobacter a...
Q6NA63         33 VLFGLRLSASVCLALFATYYLELQNAFWAATTAAIVCQPNLGASIQKGRFRAIGSALGALVMVALLAAFPQQREPALLLL 112 Rhodopseudomon...
WP_015958941   19 ASYTLRLTLSCAVLITLFMTLQIPFLAVALIVVFYVSQPNVLMIKLVSVVFFVTVTVALGGVLLIIKWTYDYPLIRLAAS 98  Klebsiella pne...
Q63MA6        119 TLWVAGCIAAAV-R-----NRH-FRWYGYVLAGYTAALIGLPAVM-APNTLFLSALTRAAEVAVGIFCSGAVSALVL-P- 188 Burkholderia p...
Q5FSY9         94 ALWISACAFVGS-L-----ERD-FRSYGALLAGYTVALVAIPTMD-DPQNIYPVSIARASGIAIGVASIAVVNILSGsP- 164 Gluconobacter ...
O05543        121 AVGIGTFCMIGTfMpgpasMTN-YRIHGMRASGFTYAIVSLDGIA-DPHHIFAISMSRATYILLGIVLEASISGLFQ-Lg 197 Gluconobacter ...
Q5FUL5        122 ALWIGLCSGFAT-F-----VSN-FRSYALVLAGYTCSIICMGAAS-NPDNVFMVAMSRGTYIVLGVLCEAFMGLIFA-Ts 192 Gluconobacter ...
Q5FT35        114 AVWIGLCTALGT-L-----VHN-FRSYAFVLTAYTCSIVSLSAQA-QPDQVFSIAMARGTYILLGVICGTVADMACR-Sn 184 Gluconobacter ...
jgi:Pden_0233 103 ALWLALCCGLTN-A-----MRH-QRAYGAALAGLTASVVVTLTTG-TEIAPVSFAGARIADTLIGIGAALAVGFMLQ-P- 172 Paracoccus den...
jgi:Daci_5715 105 AVWLGLCAGVGN-L-----QRS-FVAYGTMLSGYSAAMVALLDFA-HPDQVFALGWDRLFTALTGVFAALLVGWLFT-P- 174 Delftia acidov...
WP_012113326   97 AVWIGLCAGAGN-L-----LRG-FASYGAMLAGYSAAMVTLLHST-LAAGPFVVGIDRMLTVLLGVGVALAMGWMFTaPa 168 Xanthobacter a...
Q6NA63        113 ALFCGLCAAAAT-L-----LRN-LAAYAAALAGITSAIIFADTVT-DPSSAPFLAIVRVGEIYIGIWSATVVAMLTG-S- 182 Rhodopseudomon...
WP_015958941   99 VALFFCALYLMR-------VLGkLGLAFFVVALAVIYAQTFPSMTsQSEILVRLLLWLWVAINTAILVTLLVNACFQ-Q- 169 Klebsiella pne...
Q63MA6        189 --LSSSDALMRTLSARHADFVAFAASTTAGAVERGEFeRRFADFVDGIVGFEATRAFATFEDPYIRARSRRLARLNSEFM 266 Burkholderia p...
Q5FSY9        165 ---EAWRRLSTAMETLSHRVRQTGKSAIMGEPIATP--EEMIGLSGEILALMTQISYARTEVERGRLRMAGARLGIIGML 239 Gluconobacter ...
O05543        198 ltKRTRHQLASTFEDTLKPALTAIAGILVGKEGAMQ---NVQAIFAQITTLGDQVEFAEVELGRHDHAGDHARAALADIA 274 Gluconobacter ...
Q5FUL5        193 qeRHARAQLRQKLESALVLVTTTLCSLLGEERGALN---AARRQFGTILTINDQIEFAEVEMGPHGHEGDHARAALAAVS 269 Gluconobacter ...
Q5FT35        185 vpGKARAAIRSQLQQIVLEAANASRDILLEHGTPES---DLHNIFSLSLSLSDRIEFSAIEIGRTRGIVDYARATLGLAS 261 Gluconobacter ...
jgi:Pden_0233 173 --RARAQTLSARSATVLADGLRLVGMALQQHQTDLV--ARESAFLSTLAAISAGAEDAAAGSLRARRGLRPLNTIFASLL 248 Paracoccus den...
jgi:Daci_5715 175 --KGSGIPGNAEVRQLFAQLLRDLAGSLQARGRASLGsQEIAARLLAMAVIEEGLDPHAAGSQRSREAVHALRRLMNAQI 252 Delftia acidov...
WP_012113326  169 dpDDPARRVRRLTRRILDDLAAHLAGTLPPGRG------EHQTLLSEMAAIEDALDGHAAGSLRSRATIRAIRRLLTAQV 242 Xanthobacter a...
Q6NA63        183 --GSARRQLCQTLGRISANLLAGFSTDVTSGRGAADSrAARIALARELGPLNLAIDAALGEQSPVLADRARLRRIPFALL 260 Rhodopseudomon...
WP_015958941  170 --AFPGNQFKARLAGMLHEVARRLAAPDAEAPPTFG------ETAAQFNQLQSLFAQASRATPEIAADPLAWRSRLAATL 241 Klebsiella pne...
Q63MA6        267 NACARLHAFHQLLRRLRANHAAEVLTa--IAPHVDALSGvlyalradlarpr----arsapspspspaLVALSAYLAALP 340 Burkholderia p...
Q5FSY9        240 TVLTTSRAIAWLLETGGI-----------SDILIRHVRAwh-------------------------erSEDGTTRLETMD 283 Gluconobacter ...
O05543        275 VLLARALDLATLMRLPLSQDDMFRQEaeaIRDMFLKLPArlee----------------------tesMASILADLLTLR 332 Gluconobacter ...
Q5FUL5        270 ALLSRGFGMAMRLQVLNHNHPAFTKT---ADEILAFLKQfpqrlpdqnavpalladlqhfrdicrlyaAPHRESDVRSDF 346 Gluconobacter ...
Q5FT35        262 RLMSRALGMRSRLGAVSRRSARTQDLlqdAAGLLDRLRAdidd----------------------ekaLQALRQAVLALI 319 Gluconobacter ...
jgi:Pden_0233 249 DLIVVARMIRKASESRSITRQAD------LAALRAELERaa--------------------------dALQETGKLDPLP 296 Paracoccus den...
jgi:Daci_5715 253 SALLWLRDAPSQE----------------PPATFGEAQAla--------------------------aAQALREAAVALE 290 Delftia acidov...
WP_012113326  243 ALLLWMRRPPRPACDGA------------LVAAVRQATAaf--------------------------aADRPQDAEAHLR 284 Xanthobacter a...
Q6NA63        261 DALTSWRNAARFGERSSVAETTSRGE---LRASLAAIDPar--------------------------fQSDPAGFRDSCR 311 Rhodopseudomon...
WP_015958941  242 RCYQLAALLQADEADSDDRQQ--------LSQAVLQLKNal--------------------------sEEPFDGAIPPLT 287 Klebsiella pne...
Q63MA6        341 KRA-RASRRGLEtlapag--vldfdTAIELLYRFVDEFLGYAETHASLALDSHV-LE-----RSVTR--YAVKTNRYFVG 409 Burkholderia p...
Q5FSY9        284 TIL-DGIRKEDPdfv-------psaREAWFFERCSTLLSNRLHIRTGMNTLLRAtPAgd--aLKLAH--LESNPDYVTAF 351 Gluconobacter ...
O05543        333 RQCrQKVVSDFStaqpddaareavlRHGMLQQALVELIDALRMALTQFEASRHPgS------HDHFHspIRSYRDWQQAI 406 Gluconobacter ...
Q5FUL5        347 EPI-PGLEPFDQtdegqe-mqedrlDERILFVSLGELLGDLEQAIKEYEASTHRiKGd----HFHFQ--LETHRDTREAV 418 Gluconobacter ...
Q5FT35        320 ERC-QEDVEQTVslpraesdsgtvfNDRILIQGLQLTLTELQHLLSCLAGDPGEdPR-----AESYR--LARPRNWYAAI 391 Gluconobacter ...
jgi:Pden_0233 297 ALG-MAERIAAD--------------HAELKAILGSFAAELREIAQSHQALAHPgRT-----VCAAR--LHPQPDLTGLR 354 Paracoccus den...
jgi:Daci_5715 291 TRV-QLHEAAAAlvr--------arEAAVAWPGAADMLAPMGFALQAHLAATHDvALppghrARQWP--VVLHSDWLGAR 359 Delftia acidov...
WP_012113326  285 DDA-GRTGSDRM---------------------LHDALEGLAEAEATQPNGADGaRT-----GAHDG--VVLHRDLIGAR 335 Xanthobacter a...
Q6NA63        312 TAL-RRIDATRSs-----------dVDAPIVVAARDVVQGLAAAADGMLAKGAVgSNg----RTPRA--SFVVADPLPAL 373 Rhodopseudomon...
WP_015958941  288 LSG-RGVNRAVL-------------------QEMATTLQRLAQ--GEPVALPQGeVE-----KAPLL--APDAWRNPAYL 338 Klebsiella pne...
Q63MA6        410 FTFLRTLVAMGAMSAFWIASEWSSGSLAVIGTAIACALSSTAPRAS-RFVAQMAAGAALATLTGYLYVCRVYPNIDG-FP 487 Burkholderia p...
Q5FSY9        352 INAMRVLLGFSVASALCLASSIPASVTALSQTALVLTLASTAIDTA-QFGKGAIIGMPAGILVAAWLDFMILPHVES-ML 429 Gluconobacter ...
O05543        407 TNSLRSSVTVFGAGLIWICTAWPSGLTFIMFVCIVCSLFSTLERPA-LATQAFLRGACCAVVAAGILNLALMGKSTT-FE 484 Gluconobacter ...
Q5FUL5        419 HNGLRGACAVLITAYIYEVTAWPNGPGFIAITTLVCGLFATKENPV-LGTTEFLKGAVAACIVAWILVFVLMPKVTT-FE 496 Gluconobacter ...
Q5FT35        392 HNGLRSCAAVLMAAYVWEVTAWPDGPLFITFVSVVCARFASFSNTV-LASSAFFSGAVWAAIAAIIPVFLVMPATAS-YA 469 Gluconobacter ...
jgi:Pden_0233 355 RAMARGFLAIAASALVWTVTGWEAGRFLVLGASIFTVLFATLDQPL-PLVRQGLIGGAVAALAAVAWRLDVVPFAE--VP 431 Paracoccus den...
jgi:Daci_5715 360 RAMLRASAAIAIVGLLWVVTGWSGGAYMLLGMSIMLTVFSGFENPS-ATMRHVTLGQAMGVLVALACQWLVWPFAGS-QA 437 Delftia acidov...
WP_012113326  336 EALIRATVTLLAVGAAWLATGWEAGAFMLLGAAIMTSIFSTADNPA-QTLKQVMMGQMLGAAGALTCRWLVWPHADS-AF 413 Xanthobacter a...
Q6NA63        374 VNGARTAAAILAVTWFWVVTAWPSGPFAIVFTAVATLIFASFGDHAgDLAKDYTIGVALMAVVGSVLYFGVLPALSS-FA 452 Rhodopseudomon...
WP_015958941  339 HFALKTLLATLICYVFYTAADWQGLHTIMLSCVIVA--QPGLGATM-QKTWLRIGGALLASLLALLLIVFVQPWTDSlTG 415 Klebsiella pne...
Q63MA6        488 LLCAALAPVLAAGAYLATRPGKSG-YGIGFVVFFCLLAGPDNVIVYAPDVLINNGLALVVSMLAASIAFAVVFPAEMPWL 566 Burkholderia p...
Q5FSY9        430 GLALVLLPQTIISCLLLMNPKTSA-IGFNYGVFFLVFIGLGNHHNYDPLAFITRNTFYAMAAVLSFVLLVLLWPPTARRH 508 Gluconobacter ...
O05543        485 MLGMWSGLAMMIGGLAFAYPPLTL-PAVSYNLFLPILIGPSNQAKTDEIVYFNTALPLVLGLLYASWMYRVFLPYDPAHQ 563 Gluconobacter ...
Q5FUL5        497 TLALFLGPAMFLGGLAKGNPATAG-GSAAYGLLLPAMLGLENHHVMNEIAFYNGNMATVLAVAVSVIVFRSVLPFSSDAE 575 Gluconobacter ...
Q5FT35        470 MLCLTISVPMLIGGLATRTPALAA-RAASFSNFFPYLIGLDNHSRINEAEWFNTVFALLSGLGFGVLVFRYVFPFQLTRF 548 Gluconobacter ...
jgi:Pden_0233 432 WFSLLLALPLFCAASLLQASRATIfAGLTFNMFFAVLARPVDMLPSSSQVVVASAAMLILGVAISDFFYRWVLPMDVDRR 511 Paracoccus den...
jgi:Daci_5715 438 GLVWLMLPFVYVGALLFSHQRTAL-SGYDCNMVLLLLLQPHYPQTASFGHALALGLAVVSGPLAGWAAYRFILPVTLQGR 516 Delftia acidov...
WP_012113326  414 GLVLAMMPFILLGAFIQAHRRTAGpIGFDYSMVVLLMLQPAWPLAGTLAHSLMLAGAVVLGPAVGLMAFLLIFPVDGHRR 493 Xanthobacter a...
Q6NA63        453 ALIAVLSVLFIVLGVMQAGPWHSV-VFLAMTISSLPLLGVGNPITYDASAYFNLALAIVSGSAVGAMFFVAIPVVPPSLR 531 Rhodopseudomon...
WP_015958941  416 LLAMSLPVLALAAWIAAGSERIAY-AGIQIGFTFALAFLSWFAPLTNLTELRDRVLGILLGVLVSSIVHLYLWPDSEAPQ 494 Klebsiella pne...
Q63MA6        567 TGRIARDLRRQIALACDGPLQG---LDQ--RFQSSSHDLMSQLRNLLMk-----rSRRHRDALRWMLATLEIGHAVIDLR 636 Burkholderia p...
Q5FSY9        509 RFRLAVSIAYDLETQLAGHGER---MGP--PLLSRKYERLSQFLMWTDrmh--dpGLRSRRVFNRFVALEDFSSTIARVR 581 Gluconobacter ...
O05543        564 RWTMREHILRDLHRIADGRAQE---TVD--SVVSRNVDRFVRLMTNSGst----pSPVIQAYLTGILSGMRVMLNLLRLQ 634 Gluconobacter ...
Q5FUL5        576 RFRLRRIMLGELQHLAHPGFTP---RIS--VWIGRNTDRFARLIRHAGpt----pAPLIEACILGTLATLTLGLNVIRLR 646 Gluconobacter ...
Q5FT35        549 YRNFRLDLLSDLRLIGRNRRSM---TEA--VWVGRIVLGMEQLIAHTKat----sSGSNDRWLHAVFSMMTVGRNLLQIQ 619 Gluconobacter ...
jgi:Pden_0233 512 RRHIEASIRREIVSVSLRAGTP---------WAERHLSRLRHLVLEMVm-----rARADTEVVGNAVAALSLGHIAMRLG 577 Paracoccus den...
jgi:Daci_5715 517 LQSLRSMMVHELQ-DMAATPGH---ARDgrIWRARLYHRLLRLVRMSEqa----gGQLGAQAAECGLAALHVGRAIQALH 588 Delftia acidov...
WP_012113326  494 QQTLVTMMVHDLQSMAAHPGAA---RQRa-VWRARLYHRVLRLARWADk-----tGGSREQAMEGGFAVLLLGSAILHMD 564 Xanthobacter a...
Q6NA63        532 LRRLIALSLRDLRRLLSLRSTP---DQL--RWTALMARRIELLP-----------SEATADDVADLLALHAVGRAALRLE 595 Rhodopseudomon...
WP_015958941  495 LKTRLAALYRRLADCLAAPKEAvplA----PLLVAFTDSEALIHRVRAeplgtyaHPWPQAKGWPMRATLAQAEEIARLS 570 Klebsiella pne...
Q63MA6        637 REMQAFtaaqpaQALRWRALIDAVREALPrlfetpdaHRLARALKSVNLAIRAVRHTQHLWYAVPDERRr---mQRIVSC 713 Burkholderia p...
Q5FSY9        582 HYLDQAg-----HLHGLRPMVRHVRRLLA-----------HDRLGLLEAEIPELQAMFFERLSDGIREEqs-miINCIGG 644 Gluconobacter ...
O05543        635 AIRRDTr-----LNPEAGQALALIMGRMShfsg-ryhGHYGRTLRATKLAILRLRTCERNEDRPRERFVl----IAALTS 704 Gluconobacter ...
Q5FUL5        647 ALLDREy-----LPESARRPILLVLHYVE---------QSTKRHDKAARIAEAAVRRLRVLDAQETDLVtrlelTRAITY 712 Gluconobacter ...
Q5FT35        620 AYRGQNs-----LPENARAILSRLCQSFA---------SPFTGPEALELQSRDTLESFSTMETVETNSNlrlllSSITGC 685 Gluconobacter ...
jgi:Pden_0233 578 QIAHQEt-----PAADGGAITKDCLRRLA------------NPISDPAACGREILKANQAVPAETATSA--------VRL 632 Paracoccus den...
jgi:Daci_5715 589 QLSGEAa-----LGDGTARAVRAALLRLQ------------RLQQAPGQCPPLLRALAQRVAERHPDQA---------RQ 642 Delftia acidov...
WP_012113326  565 EALNQSd-----PAPGTARRLNAALARLR------------HVGSDPERAARALGVAATRLAADGTGDG---------DL 618 Xanthobacter a...
Q6NA63        596 QEV---------SDHRALGLLRAALTALAdghladarMMLVTWRGQSLALDPPDDAEHRRWIASQSHIA------VIIDA 660 Rhodopseudomon...
WP_015958941  571 E-----------GYRLNAAPGDPTLARCA-----------EQLRRYAERIEQEATAPGEQLTADLTNPFgp-alAAALAA 627 Klebsiella pne...
Q63MA6        714 LHFIRSALIDQDAPF 728 Burkholderia pseudomallei
Q5FSY9        645 LEAVRTMVRLNRSAV 659 Gluconobacter oxydans
O05543        705 LDVIATELDTNRIFF 719 Gluconobacter oxydans 621H
Q5FUL5        713 LVVIAYTMRTNEDFL 727 Gluconobacter oxydans
Q5FT35        686 LIIISSELGRRNDIL 700 Gluconobacter oxydans
jgi:Pden_0233 633 AHLMARELVDHPKVF 647 Paracoccus denitrificans PD1222
jgi:Daci_5715 643 LRHAAHEIAQHEAFF 657 Delftia acidovorans SPH-1
WP_012113326  619 LREAAAELSQRAAFI 633 Xanthobacter autotrophicus
Q6NA63        661 IDNHPVLLATPFRGW 675 Rhodopseudomonas palustris
WP_015958941  628 LPDWGPTPIATEQQA 642 Klebsiella pneumoniae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap