3FKS


Conserved Protein Domain Family
ATP-synt_Eps

?
pfam04627: ATP-synt_Eps 
Click on image for an interactive view with Cn3D
Mitochondrial ATP synthase epsilon chain
This family constitutes the mitochondrial ATP synthase epsilon subunit. This is not to be confused with the bacterial epsilon subunit, which is homologous to the mitochondrial delta subunit (pfam00401 and pfam02823) The epsilon subunit is located in the extrinsic membrane section F1, which is the catalytic site of ATP synthesis. The epsilon subunit was not well ordered in the crystal structure of bovine F1, but it is known to be located in the stalk region of F1. E subunit is thought to be involved in the regulation of ATP synthase, since a null mutation increased oligomycin sensitivity and decreased inhibition by inhibitor protein IF1.
Statistics
?
PSSM-Id: 398354
Aligned: 107 rows
Threshold Bit Score: 39.8346
Threshold Setting Gi: 74694979
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3FKS_I          1 SAWRKAGISYAAYLNVAAQAIRSSLKTELQTASVLNrSQTDAFYTQYKNG 50   baker's yeast
XP_004991740 1548 ASWRAAGLTYIQFSNIAARMVRHALKPEAAKEATKR-AGGNINVRLYEKG 1596 Salpingoeca rosetta
XP_001745289    4 lAGRSVLFSYLQFSALAARFVRSALKEEAKKQAAKR-VGGTLNMRFYEKG 52   Monosiga brevicollis MX1
Q8IBU5          1 -mWKAANVSYTRYASEMADILRKCLKDPYSDIALER-SKMHIRETIYKDG 48   Plasmodium falciparum 3D7
XP_001610693    1 -mWRSAKSSFSRYTLDMAEILCRCLKSPHREKALAR-YKLDVKQTEYKGG 48   Babesia bovis T2Bo
Q4N073          1 -mWRSINTSFSKYSIELAQLLCRCLKDPFRDKALAR-YKLNLKQTNYVNG 48   Theileria parva
EEC44847       64 TFWRMAGMSYLQYVNKAATSMRGALKEPAQRKAMEQ-EAFAYKVSTWQDG 112  Phaeodactylum tricornutum CCAP 1055/1
Q75JK6          4 QYWRAAGITYLQYANICGTHVRNCLKEPFRAAAKNR-EGFISNTVMYQNG 52   Dictyostelium discoideum
EFA85977        4 QYWRFAGLTYLEYINLSGSHLRNCLKEPFKAAAKNR-EQMFSTYTTYQNG 52   Heterostelium album PN500
XP_004354718    4 QFWRVAGLTYLEYVNLTSSHLRNCLKDKFKVAAKNR-EAFASTYTSFANG 52   Cavenderia fasciculata
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap