5HK1


Conserved Protein Domain Family
ERG2_Sigma1R

?
pfam04622: ERG2_Sigma1R 
ERG2 and Sigma1 receptor like protein
This family consists of the fungal C-8 sterol isomerase and mammalian sigma1 receptor. C-8 sterol isomerase (delta-8--delta-7 sterol isomerase), catalyzes a reaction in ergosterol biosynthesis, which results in unsaturation at C-7 in the B ring of sterols. Sigma 1 receptor is a low molecular mass mammalian protein located in the endoplasmic reticulum, which interacts with endogenous steroid hormones, such as progesterone and testosterone. It also binds the sigma ligands, which are are a set of chemically unrelated drugs including haloperidol, pentazocine, and ditolylguanidine. Sigma1 effectors are not well understood, but sigma1 agonists have been observed to affect NMDA receptor function, the alpha-adrenergic system and opioid analgesia.
Statistics
?
PSSM-Id: 398353
Aligned: 107 rows
Threshold Bit Score: 192.329
Threshold Setting Gi: 198435068
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5HK1_A        28 QVVWLW----LG-TqSFVFQREEIAQLARQYAG----LDHELAFSRLIVELRRLHPghVlpdE--ElqWVFVNAGGWMGA 96 
Q55BU8        42 IKIKLM-------R-CIELDTKILHECTKKGVG----LPIDEAFEAIHKELIKHYPqf--itAkrN--WLLFNGGGAMGQ 105 Dictyostelium d...
XP_004354668  54 IKIRVL-------R-GVKLDVKVLHECTKKGVG----LPLDKAFDVINKEIAIKYPgl--inTnrR--WILFNGGGAMGQ 117 Cavenderia fasc...
XP_002132149  14 YLLLHWykviKP---SYVFKVNTVKEIAQKESGysy------shhGIRQAFRKRYPdyVlqeQdfP--FLPSHTGGLDGS 82  vase tunicate
XP_003385318  28 GGIRLR----LNsK-EFIFDEKEVSAITKAALAstrgQPVKETLSLIEKRLREKHGdhIlpkEhqK--WIFVNCGGWMGA 100 Amphimedon quee...
XP_783805     15 YGIHLW----LNtK-SYLFDDQTIARIAEKYVG----LPHQDAFDKVGEVLREQYPghIlpkEreE--WIFVNAGGWMGA 83  purple sea urchin
EKC41135      24 FCIQYW----LNkK-QHLTSGEEIAAIVKKYSGvk-sSEAKTAFDKIATVLRRKYPghIlpeEdmQ--WIFMNAGGWMGS 95  Pacific oyster
RMC16515      24 QGLRGW----LAaK-RYEFTPAEIAQLARHHAG----LDHELAFSKIIVELRKKHPghIlpdEdlQ--WVFVNAGGWMGS 92  Hirundo rustica...
XP_002114453  20 IITQRW----LDnK-SYLFSHDEIAEVAKKAVG----MPIDDALANVTAELKIRYPrhIl--EesE--WIFINCGGWMGS 86  Trichoplax adha...
ESO05163      20 YLVNIW----LAnK-KYIFSEEAIIKIGKKYQEp--tVDMKKVIESIHKDFKAMYPdhIlpkDdvQ--FVFFNAGGWLGA 90  Helobdella robusta
5HK1_A        97 MCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVE 176
Q55BU8       106 MCVLHASLSEYLIFYGTPLYSQGHSGRYLMDVYDFMIQGTTKQFFPGKFQSIDFPAGKFSYLPMMVAKGYCCEPNSWMLE 185 Dictyostelium d...
XP_004354668 118 MCVLHASLSEYLILYGSPLYSQGHSGRYLMDVYDFMIKGETKTYFPGEFAPRVFPAGEYSYLPRLVAKGYCCEPESYMLE 197 Cavenderia fasc...
XP_002132149  83 VSVLYASLHEFLVLYHAEIETTGSTGRHYMNISVSVLKGTISISQSSFTPQVSYSKGDNHVLRMGTTSTVKLAGGTTLLV 162 vase tunicate
XP_003385318 101 MYILHASMTEYVMFFGTGIDTSGHSGRYLAEITDTLVSGTMRQWKEGGMVVKEYGIGDYVHHAPGEVTGVQWTSGTIMVE 180 Amphimedon quee...
XP_783805     84 MCLVHASLTEYILFFGTAVDTSGHSGRYWANVSDTIMTGNFRQWKEGTTESEEYGPGVTLLHAWGEATSVQWTAGTWMVE 163 purple sea urchin
EKC41135      96 MCLMHASLTEYILFFGTAVETSGHSGRYWAEISDTLITGSMRQWREGELQAHIFKSGDTVPHPMGNATAVYFEADTWMVE 175 Pacific oyster
RMC16515      93 MCLLHASLTEYVLLFGTAVDTGGHSGRYWADISDTIISGTFRQWKEGTTRSEIYYPGDTIVHQAGEATSVQWSAGTWMVE 172 Hirundo rustica...
XP_002114453  87 FYLLHASITEYVLVFGTAIDTSGHSGRYWATISDTILSGSFRQWKEGTTFSNVHRPGTTVIHEIGEVTAVQWSPNTWMVE 166 Trichoplax adha...
ESO05163      91 IYMMHASLTEFVLVYGTTMDTSGHSGRYWVNRTDIILSGEMLEWKEGEVKSKVHKPGSVVKYAWGEASAVTYKANMWKLS 170 Helobdella robusta
5HK1_A       177 YGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLEL 218
Q55BU8       186 YGRGVIPLALPYFLFSSIFVTLDIVPWISAVFYVGREVTKNL 227 Dictyostelium discoideum
XP_004354668 198 YGRGIIPLALPYFLCSSIFVTLDIVPWLTACYRVGYQVTKNL 239 Cavenderia fasciculata
XP_002132149 163 YGRGIMPLTAGYWVSDSIFSHSDPILAVTTIWLYLKAVLlsn 204 vase tunicate
XP_003385318 181 YGRGVIPSTLLFALADTVFGTTDFVVFYETIKIYAISLGREL 222 Amphimedon queenslandica
XP_783805    164 YGRGFIPSTLPFAVSDTIFSTQDFYTLYRVVRIYGEALFQEL 205 purple sea urchin
EKC41135     176 YGQGFIPSTLTFALADTFFSTTDFVTLFYILRVYAKALFMEM 217 Pacific oyster
RMC16515     173 YGRGFIPSTLAFALADTLFSTQDFVTLFYTLRVYAKGLLLea 214 Hirundo rustica rustica
XP_002114453 167 YGRGFIPSTLGFALSDTIFGTQDFVLLFRILRIYARAITQEL 208 Trichoplax adhaerens
ESO05163     171 YGRGFIPSALPYVTSSYIFGNHDYLSLYNMFKIHVKSFwqef 212 Helobdella robusta
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap