Conserved Protein Domain Family
Utp14

?
pfam04615: Utp14 
Utp14 protein
This protein is found to be part of a large ribonucleoprotein complex containing the U3 snoRNA. Depletion of the Utp proteins impedes production of the 18S rRNA, indicating that they are part of the active pre-rRNA processing complex. This large RNP complex has been termed the small subunit (SSU) processome.
Statistics
?
PSSM-Id: 398348
Aligned: 139 rows
Threshold Bit Score: 306.578
Threshold Setting Gi: 74856267
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CCF49424      222 ESEAD---ASddn-----------------ddnDHSSTKLAQHIQSYASagskrpttssdddrensdgepsakRTRRYVL 281  Ustilago hordei
XP_012408699   75 EGDHNn--------------------------dERKHQKLLNVICGLGG------------------------RKRLKLA 104  Tasmanian devil
XP_014310689   53 EGDSGg---------------------------ERKHQKLLEAISSLDG------------------------KNRRKLA 81   little brown bat
EKC20821       15 SEDEDd---------------------------DKRHAKLLDAISGLGG------------------------KKVNKRS 43   Pacific oyster
XP_001944030   12 DEDMDdv-------------------------sYEKHRKLLQTITSKTKr-------------------------KIQPS 41   pea aphid
EFA08495        7 DNYEDlysEEd----------------------ASKHDKLVQKVLSLNK------------------------TQQLKKP 40   red flour beetle
Q16XZ7          9 EIDQFd---------------------------PVAHRKLLAGINSIVR------------------------SQDVQKA 37   yellow fever ...
EDO42017       33 SESEDe---------------------------GSKRQNVIKAIENLDK-------------------------KKRKRQ 60   starlet sea a...
XP_023351348   43 ENNNNdaydgevdskvdridddsgnnendnnnnERKHQKLLNVICGLGG------------------------KKRLTLA 98   Tasmanian devil
NP_001008205   20 EEDSDv---------------------------ERKHQRLLDAISSLDG------------------------KKRRKLA 48   tropical claw...
CCF49424      282 SERTEAIPETEFAAAQ-----------SGSTLRLEDFMSPLssnidFADVRKSTKLLSnpksssftsasaaskKGGGALS 350  Ustilago hordei
XP_012408699  105 ERSEASLQVSEFSVSTeg---------tGEKLELSELLAPIkvsssLGSVKKRLKNV----------------KNKKTVE 159  Tasmanian devil
XP_014310689   82 ERSEASLKVSEFTVSSkg---------sGERLVLSDLLEPVktsssLATVKKQLNRV----------------ISKKTVE 136  little brown bat
EKC20821       44 QRTVPTNQVSEFNFTAat---------dDTKVKLHELVGTLktsakHGSLKNQLNRV----------------QNQKVLS 98   Pacific oyster
XP_001944030   42 TRNEPSLQVSEFHLSS-----------GQQTTNVDDLTNALkk--kAPQIRQKIQVAK---------------STKKLLQ 93   pea aphid
EFA08495       41 SRTEPTLQISEFNLVKsi-------tgHKGAVHLNDLAKTLksrksRLKISENVKKIQ---------------RHSRTLP 98   red flour beetle
Q16XZ7         38 TRTEPTIKKSEFNLVKarfssedghsrSKSAIKVDDLLGILkktgkNVSLSKDLAQIK---------------TKKKTLR 102  yellow fever ...
EDO42017       61 LRSEPSQQVSEFNLASnt---------eTDKVDVSDLVGLLpksstYGRLKKKLASME---------------KSASPMD 116  starlet sea a...
XP_023351348   99 ERSEASPQVSEFNVSTeg---------tREKLELTELLAPIkisssLGTVKKQLKNV----------------KNKKTVE 153  Tasmanian devil
NP_001008205   49 ERTEASLQVSEFGISSeg---------aGDKISLSDLIEPIqksnsFSTVKKQLNNL----------------NQKKSVE 103  tropical claw...
CCF49424      351 APLPSVVQDRLDRSGAYSITRDEVQGWQPTINRLRDAEHLSFPLQK--PAVTKQSTSGLVATFNPDGDMESSIAAMLTEG 428  Ustilago hordei
XP_012408699  160 LPLSKEENERVLREAAYNKISQDMDKWEPIVMKNRGAAQLVFPLEQ--ERVLDVPIEEVIEGWKVSTPLEKEIFSLLHKN 237  Tasmanian devil
XP_014310689  137 LPLNKEEVERIHREVAFNKTSQALSKWDPIVQKNRQAEQLVFPLIK--EQSAFAPMEHVLNAWKARTPLEQEIFNLLCKN 214  little brown bat
EKC20821       99 VPLPKHQKEKIERELAYKNTSKEVSKWDSVVNSNRQAEQLQFPLQK--SEVHLLNTTGKFKQLKPRTPLELEIAAVLSGN 176  Pacific oyster
XP_001944030   94 KPLDKVHADKIKRAVAYDNFKKHISRWSAVIEKNKSADQLRFPLRSseVEVFDNRMVDFTRGFSHPTDLQKKISAVLQSS 173  pea aphid
EFA08495       99 KPLKKPQANRIRRSVAYEKTRLELDRWEATVTANRVATNLSFPLDNd-YKLEKKENKNFTSMWRVKSALQQELEKIEPTV 177  red flour beetle
Q16XZ7        103 KPLEKPLADRIQRDTLYGKAQTNLDLWEPVVTASDVAPQTVFPLQYg-NVGLVNEAPQKLSQYRVKSDLMKAMEELDRKY 181  yellow fever ...
EDO42017      117 LPLQKPQAEKIQRTVAYDETKTDITKWQPIVKKNREAEHLTFPLNP--YKPAEITTKTLAVTFKPRTPLEEEVAAILRGS 194  starlet sea a...
XP_023351348  154 LPLSKEENERSLREAAYNKISQDMNKWDPIVMKNRKAAQLVFPLEQ--EQGLDIPVKEVLESWKVSTPLEKKIFSLLHKD 231  Tasmanian devil
NP_001008205  104 LPLSKEETQRIQRAAAYQEASEEVEKWDHIVKQNRKADQLVFPLNQ--EILKPTPIEEKITGWTARTPLEQEIFSILQKN 181  tropical claw...
CCF49424      429 G-L-------TEKQLAQQEDLAMNKLDPEEARARRDELRRMRMLMFRAEQKAKRVSKIKSKAYRKIHRKEKERLKAqmke 500  Ustilago hordei
XP_012408699  238 KqPv------TNTVLTPEEKASLKAMSLEEAKQRRAELQKARALQSYYEARARREKKVKSKRFHKMLKKKKNKEVLkqfe 311  Tasmanian devil
XP_014310689  215 KqPv------TDPLLTPVEKASLKAMSLEMAKMRRAELQRARTLQSYYEARARREKKIKSKKYHRVLKKGKAKNSLkefe 288  little brown bat
EKC20821      177 SdVlp----tENNELTPAEERALAAMDLEEAKERRAELQKFRALMSYKEAKAKRQKRIKSKKYH-IQEKEKLKHEKkale 251  Pacific oyster
XP_001944030  174 KiVqqkqkdlKMSWIEKEKE--KYPLTLKELLEKRKSMANFRAKESYRHAKAHRQNKIKSKKYHRLLRKEKTKEQIkefe 251  pea aphid
EFA08495      178 E----------EYHIDLEKE--KFPLTMKEMLVRRQEAAKLRAYQGYREAKARRQRKIKSKKYHRIQKREKIKKQLkefe 245  red flour beetle
Q16XZ7        182 Q---------KDEPEEAEED--KYTLTLEELRQKRKEAARQKMREAYKIAKGRRMNKIKSKKFHKLMKREKIRNQIkqfe 250  yellow fever ...
EDO42017      195 SkVie----rENKELTEEEEQALLAMDLEEAKERRRELQRMRALQSYYEEKCRRAKKIKSKKYHRVKKRAEKRAAGkqnl 270  starlet sea a...
XP_023351348  232 KrPv------TTAFLTSEEKASLRAMSLEEAKQRRAELQKARALQSYYEARARREKKVKSKKFHKMLKKKKTKEVLkqfe 305  Tasmanian devil
NP_001008205  182 KqPl------TDPLLTPVEEASLKAMSLEEAKLRRAELQKARALQSYYEAKARREKKIKSKKFHKVLNRSKQKETLkefe 255  tropical claw...
CCF49424      501 lgggsddegvIGEvdeeeemkERLKAERDRARERATLKHKNTSKWAKNILsaRHGEhNQEARNELDAQLRKGAELRSKIQ 580  Ustilago hordei
XP_012408699  312 elr-kinptaALE--------QLQKIENARIQERMTLKHQNSGKWAKSKA--IMAKyDLEARKAMQEQLTKNKELTQKLE 380  Tasmanian devil
XP_014310689  289 klr-ktnpaaALE--------ELEKLEKARMMERMSLKHQNSGKWAKSKA--VMAKyDLEARQAMQDQLARNKELTQKVQ 357  little brown bat
EKC20821      252 ele-kndpaaYQE--------KVEDVERQRIEERMSLKHRGGSKYSKKQM--LYAKyDDQARQRVQDMLHTSRQLTQKSV 320  Pacific oyster
XP_001944030  252 klq-dtdpvaALE--------KLNVIEKTRAEERASLRHKSTGQWARNHV--VRAKyDKDSRIALAEQLRKSKELTQKVQ 320  pea aphid
EFA08495      246 llq-ktnpeeALK--------KLEEIEKTRIEERFSLRHKSTGKWARNQQ--VRAKyDKESRQVLAQQLTLSRELTQKLk 314  red flour beetle
Q16XZ7        251 elq-ktdpeaALK--------QLELIEKQRYQERATLRHKNTGSWAKNMQ--IRAKyDMNVRKEISEQLSIGKELMAKQl 319  yellow fever ...
EDO42017      271 eelqksdpdkARQ--------ELEKLERARAEERVSLKHRNTSKWAKSLL--VHGNkDPEARKALHDQMLLSRQLTEKHq 340  starlet sea a...
XP_023351348  306 qlh-kisptaALE--------KLKKIENARIQERMTLKHQNSGKWAKSKA--IMAKyDLGARKAMQEQLIKNRDLTQKLK 374  Tasmanian devil
NP_001008205  256 elk-ktnpeaALE--------ELQKLEKARMEERMSLKHQNSGKWAKSKA--IMAKyDDDARKAMQEQLQKNKELTRKIE 324  tropical claw...
CCF49424      581 GRvigedsdqySSDY------SEGEDGEDGEEgv---------------------------------------------- 608  Ustilago hordei
XP_012408699  381 VPsese-hdedEEEDagl-ipAIVNEVQLSIDgpnpwmq-------------------------------------kqrl 421  Tasmanian devil
XP_014310689  358 VAsese-eeegGEEEvdllvpDAVNEAHMTADgpnpwmv-------------------------------------rnhs 399  little brown bat
EKC20821      321 AVsdse-ndeeEAMD------SEDEMIERELSslssn-----------------------------------------pw 352  Pacific oyster
XP_001944030  321 PSlnet-ndsdSSDE------EQIEISEQVVDpdnpwlaerkefkdfmvgy------------nnfvqnncetkdtndqy 381  pea aphid
EFA08495      315 nnn----sdsdEDEA------KEEEKVPEVIDkdnpwvngikpgkdvadfisgyrkywmeknkegetgqlqedaqenvtv 384  red flour beetle
Q16XZ7        320 ae------desSESG------EEEVVMEEDEGednpwvrrkkgeheaeanl------------eftsgyrkywdqrnkve 375  yellow fever ...
EDO42017      341 qes-----dseDYEE------PDPDQHDVTSDgfgglvtsgdnpwsidkt--------------gdqvrsgvdpdepepi 395  starlet sea a...
XP_023351348  375 VPsdse-hnedDEEDvgl-ipAIVNEVQLSIDgpnpwvq-------------------------------------kqhl 415  Tasmanian devil
NP_001008205  325 VVsese-gseeEEii-----pDFVNDAQVNLEgpnpwmtg----------------------------------klsset 364  tropical claw...
CCF49424      609 -iGDAFDELAALEAKEeakrr---kdeeEFEKVGGKKGV-----YNMKFMKDARERQY-------------AAVRGEVDD 666  Ustilago hordei
XP_012408699  422 nhVKNSPTQKKPvanea-------aeseEEEEATAEDEL-----LLREVEERRAFWKSsk-------------------- 469  Tasmanian devil
XP_014310689  400 ddAKEAEIQKDSE-QLpepmaneaseseEEERPVAEEEI-----LLKEFKESQLLRKM---------------------- 451  little brown bat
EKC20821      353 mkvAAHPVAKSEFSRPeivlnsegkekeESESESDEDED-----VLMKMGRELEKRQKkpvha----hlveEEMEKIIQK 423  Pacific oyster
XP_001944030  382 inNNKNEETKESEESN------------VNEVKHDKTAI-----PIVKIKKKNQNKVKnitiqdlsifdeeESFVEGLKI 444  pea aphid
EFA08495      385 seEIQMENNKQLEEEAstidegyrveknKDEEEKTEQSQedspeATLTISEEKVTKKK---------------KQSKVGK 449  red flour beetle
Q16XZ7        376 evKKRMENEDQDEDEHesgdeeaglgseGEEQDDGDSEEe----RQLEVFKKKVKKSKavstsa-weeedlSESDDKSPT 450  yellow fever ...
EDO42017      396 tkLQRLQPIKDENNRDiegegdssegekDDDDD-----------FELQLAKPEPEGKK---------------------G 443  starlet sea a...
XP_023351348  416 kdTKNSPTQKKPaanev-------aqfeEEEEATAEDKL-----LLQEAEERWAFSKK---------------------- 461  Tasmanian devil
NP_001008205  365 kdVAQDVDCKMQSDTEednnikatekdsDPEEELSEDEV-----LLKEFEDKRCERRE------------------QAKE 421  tropical claw...
CCF49424      667 FvmeMQQ----FQAEGGSGSESE-------DqgemviprkdaeggsstyvqGNKGR------ALY--------------- 714  Ustilago hordei
XP_012408699  470 ---vEQG----LQNHTMTTMTVPektkedeEllvhlr------------------------------------------- 499  Tasmanian devil
XP_014310689  452 -----SG----LNQDTKPVGRQEtedsstqEvlsklr------------------------------------------- 479  little brown bat
EKC20821      424 QgdqRQE----KEKSVKASGEGVknsqnkkNktqntkkaapkveenideifQKLEDkapddrK----------------- 482  Pacific oyster
XP_001944030  445 VspkKKK----VHFSDDTIKPETkineidtNikinstalcnkknnninvinTVAGTwfvtsdNINddivnkkkvhkdven 520  pea aphid
EFA08495      450 KknsTED----LKQSKSTSDWEIsvvdnatDvedmfnk------------------------------------------ 483  red flour beetle
Q16XZ7        451 VavkRKK----VSNRKEMNLEEMfdd-aqeAlekkiqek----------------------------------------- 484  yellow fever ...
EDO42017      444 TkrgKKK----TSKDATEESEAP--------------------------------------------------------- 462  starlet sea a...
XP_023351348  462 VvqhKSH----KQKQTITTTTAPrkteedeEvlvqlr------------------------------------------- 494  Tasmanian devil
NP_001008205  422 McldSEPghpsVLDQEKVEAEADet---geEqvsefn------------------------------------------- 455  tropical claw...
CCF49424      715 -----------GGNPSSTSTATATPAAASPAKKESAPKPAPAKANAgveiggeptstkpkskkpalststvadvDDDASN 783  Ustilago hordei
XP_012408699  500 ----------dlskqlKQKAKKIRQNGEQPESPPSATRSKPSV--------------------------------QREER 537  Tasmanian devil
XP_014310689  480 ---------glsqklNKDNHQCRKQNMGSVRTVLSTQREGPAG---------------------------------EEEE 517  little brown bat
EKC20821      483 -----------KVEEDVKRDTENKKKKKRRRGKKKMEDQDDEAEKA----------------------------EDMNDA 523  Pacific oyster
XP_001944030  521 afktvetelknKINEKLLNLNKTKVKQPSKTDIAKRRNEEVKSDYL---------------------------------- 566  pea aphid
EFA08495      484 ----lekklqrTMLKRVKKLKHKINKEDKTKTEPKRKKVDNKVDLT---------------------------------- 525  red flour beetle
Q16XZ7        485 ----lsnvrklTVAQKTNKNQKMNQPKSKKKSDLAFKKKASLVDAD---------------------------------- 526  yellow fever ...
EDO42017      463 -----------NKKRKEKKKKKKKKKASSKIEPTETAETDDVTERAg--------------------------------- 498  starlet sea a...
XP_023351348  495 ----------dlstqlNQKVKKMRQNGIQPVNPPSASHSKPSV--------------------------------QREEQ 532  Tasmanian devil
NP_001008205  456 ------qlfqklLEQNKSQKKERKKKSGGKTNEPVTEAEEIAV-----------------------------------EG 494  tropical claw...
CCF49424      784 PWLVIdsnghstsklsRKKNDSTLSAATSTSAASVAKSALRASKNAAKSSSALAQRRE-----DESIAVDLSTNLG---- 854  Ustilago hordei
XP_012408699  538 ALLNErpar---mveeDLEALDAEEVGQEPELRKPVLER----HSNQKNPqk---------tnEPVTDLHTIISVKphia 601  Tasmanian devil
XP_014310689  518 PLLLQrpera--qtleELKELSKEGCFQNEELPRPALEG----QQVERN--NQPSAPKkk-rkEQMIDLQNILTTKspsm 588  little brown bat
EKC20821      524 PLISEgl--------krKKTLDDLEEDEEEEESISGRSSMMAKRETEITNNGSFTEDSpntkeEVFVDPKKLFTLEtkis 595  Pacific oyster
XP_001944030  567 ----------------KMNNKRIKAEFNEPLYENNRTLDTNNISNVENNTGSAIKIVGkptkqVQNIDPTEFLQVTqisl 630  pea aphid
EFA08495      526 ------------------LNPQKKIPIIDEELIENTNSDAENSQNNETLSNLKNISTKevaqnESNIDPDKYMKVKptnl 587  red flour beetle
Q16XZ7        527 ------------------------LELNETTGKEKDDDEARFSSNIAKFFTEDKLQQStgtpsEVTINPKQFVQMKpkhl 582  yellow fever ...
EDO42017      499 ---------------lLLGNDAIDEDDDDDRDSKEDDAEDARQETARRNAKTLDLNKSnplnnGVTIDPKKIFRIEdt-- 561  starlet sea a...
XP_023351348  533 ALLNErpar---tleeDLEALVTEEVGQEQALLKPVMERQHWTHSNQKSPQkm--------neEPMTGLHTIISMKahie 601  Tasmanian devil
NP_001008205  495 PLLVGrlerk--qdleEVSALAGEEWEDEQSTSLMVSTKDDQTKKVSQSGKKKva------kkSEIIDYNKILPVKatri 566  tropical claw...
CCF49424      855 ------------HQSDSDVdsdgdsvqpahviqnltkkqkksnpkhaitAIQQrDLVSSAFAGDDVVAEFEAEKTATVAA 922  Ustilago hordei
XP_012408699  602 nsf--lsiptivEQEDCDE------------------------------DIIQkQLIKEAFAGDDVIADFQREKREAEKA 649  Tasmanian devil
XP_014310689  589 ks----savptiEELEDEQ------------------------------ERKQkQMIKEAFAGDDVIRDFLKEKRETVEA 634  little brown bat
EKC20821      596 dianpevtgrdgEEEESDG------------------------------EEAQrSIIAQAFADDDVIDEFVKEKNAIVDR 645  Pacific oyster
XP_001944030  631 ete---emaqveDHLDDKE------------------------------ENEQeKLIAEAFADDDIINEFKEEKKKLEEQ 677  pea aphid
EFA08495      588 sta------ipdiltEDNE------------------------------EPTQrEIISEAFEDDDIVQEFAKEKQDEVDR 631  red flour beetle
Q16XZ7        583 lnai-sdlttggELSDDEE------------------------------EHNQkLTIAEAFEDDDIVADFEQEKQEERDR 631  yellow fever ...
EDO42017      562 -----------gDSTGGDE------------------------------SRGQiLSIQQAFANDDVIEEFAREKDQAIDS 600  starlet sea a...
XP_023351348  602 nsf--lsiptfvEQEDCDE------------------------------DITQkQLIKEAFAGDDVITDFQREKRKTEKA 649  Tasmanian devil
NP_001008205  567 htp--llpttvdDEEDEEQ------------------------------LDDQkMIIKEAFAGDDVVNDFLKEKRSAEQA 614  tropical claw...
CCF49424      923 DESKIVDTRLPGWGSWTGKGIRHnnkpANPK-FLKKIqgidaEK---RKDAGMDRVIISERRDKKQ-DKFRVKDLPYPYT 997  Ustilago hordei
XP_012408699  650 SEPKDIDLCLPGWGQWGGAGLAIs--aRKRRrFLIKA-----PKaspRKDKSLPNVVITEKRNVHA-AAHQVNVLPFPFT 721  Tasmanian devil
XP_014310689  635 SKPNDVDLTLPGWGEWGGVGLKPs--aKKRRrFLIKA-----PEgppRKDKNLPNVIINEKRNIHA-AAHQVRVLPYPFT 706  little brown bat
EKC20821      646 DKPTDIDLFLPGWGAWGGESVKVs--kKKRKkFIIKA-----PEgppRKDKRLGNVIISEKKDKAI-SKHQVNDLPFPYV 717  Pacific oyster
XP_001944030  678 SKPKIESA-LPGWGSWAGPNIRKrtfkKRTNmgm-----frtPAkppRKDFNREKVIIHESADDSI-KSHLVSELPYPFK 750  pea aphid
EFA08495      632 DKPKDIDLSLPGWGSWGGTNIKVn--kRKKRrFTIKA-----PPkvpRRDDNKGTLIINEKAQNKI-KEHMVSEVPFPFK 703  red flour beetle
Q16XZ7        632 NKPKEVDTFLPGWGSWGGSGIKQrpvnKTRR-KMFKA-----PPevpRRDDNKERVIINEDIVSKQlSSHLVNELPFPFV 705  yellow fever ...
EDO42017      601 SKPKDLDLTLPGWGDWGGAGVKVs--eKKKAkFMIRA-----EPgpdRKDKNLAHVIINEERNRKF-ARNQVKTAPHPYR 672  starlet sea a...
XP_023351348  650 SEPKDIDLSLPGWGQWGGPGLVIs--aRKRRrFLIKA-----PKaspRKDKCLPNVVITEKRNVHA-AAHQVNVLPFPFT 721  Tasmanian devil
NP_001008205  615 GKPKDISLVLPGWGEWGGTNLKVs--kKKKRkFIIKA-----PPappRKDQRLPNVIINEKRNVMA-AAHQVNQLPFPFN 686  tropical claw...
CCF49424      998 SVAQYKAAMSQPLGKEWNTRIETQRLNMPRVMKKPGAVITPVV 1040 Ustilago hordei
XP_012408699  722 HPNEFEHTIKTPVGTTWNTQRAFQKLTAPQVVTKPGHIIEPIK 764  Tasmanian devil
XP_014310689  707 HHQQFERTIQTPIGSTWNTQRASQKLTTPKVVTKPGHIIKPIK 749  little brown bat
EKC20821      718 TVEQYEQAIRAPIGKTWNPETAVKELVKPKIITKLGGIIQPIS 760  Pacific oyster
XP_001944030  751 GIEEYEETIKAPVGRTWVPETVFQKLTAPPVVTQMGQIIDPID 793  pea aphid
EFA08495      704 TVKDFEASMRAPISNTFVPETAYRRLIKPAVTTKMGTIIEPIS 746  red flour beetle
Q16XZ7        706 TVKDYEASLRAPVGRTFIPETAHSTLVEPRVVTKMGAVIEPMK 748  yellow fever mosquito
EDO42017      673 SRTQFERSIRNPVGKHWNTANTVKELTKPRVEIQMGAIIEPIT 715  starlet sea anemone
XP_023351348  722 HPNEFEQTIKTPVGTTWNTQRAFQKLTAPQVVTKLGHIIEPIK 764  Tasmanian devil
NP_001008205  687 NRQHFESSIRAPVGSTWNTQKAFQKLTAPRVVTKQGHIIEPIT 729  tropical clawed frog
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap