Conserved Protein Domain Family
SelP_N

?
pfam04592: SelP_N 
Selenoprotein P, N terminal region
SelP is the only known eukaryotic selenoprotein that contains multiple selenocysteine (Sec) residues, and accounts for more than 50% of the selenium content of rat and human plasma. It is thought to be glycosylated. SelP may have antioxidant properties. It can attach to epithelial cells, and may protect vascular endothelial cells against peroxynitrite toxicity. The high selenium content of SelP suggests that it may be involved in selenium intercellular transport or storage. The promoter structure of bovine SelP suggest that it may be involved in countering heavy metal intoxication, and may also have a developmental function. The N-terminal region of SelP can exist independently of the C terminal region. Zebrafish selenoprotein Pb lacks the C terminal Sec-rich region, and a protein encoded by the rat SelP gene and lacking this region has also been reported. N-terminal region contains a conserved SecxxCys motif, which is similar to the CysxxCys found in thioredoxins. It is speculated that the N terminal region may adopt a thioredoxin fold and catalyze redox reactions. The N-terminal region also contains a His-rich region, which is thought to mediate heparin binding. Binding to heparan proteoglycans could account for the membrane binding properties of SelP. The function of the bacterial members of this family is uncharacterized.
Statistics
?
PSSM-Id: 398337
Aligned: 10 rows
Threshold Bit Score: 298.958
Threshold Setting Gi: 0
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P49907        23 GQSSYCKQPPPWSIKDQDPMLNSYGSVTVVALLQAS---UYLCILQ-ASRLEDLRVKLEKEGYSNISYVVVNHQGISSRL 98  cattle
Q98SV0        28 NGSRICKPAPQWEIDGKTPMKELLGNVVVVALLKAS---UHFCLTQ-AARLGDLRDKLANGGLTNISFMVVNEQDSQSRA 103 zebrafish
6_pfamImport   1 -DGPRCQLPPTWKIGDLEPMTGAMGRVTVVALLDAR---STIDFLN-LGRMDSLRQKLENQGLRDVVYMVVNHQGAQARG 75 
P70274        23 GQSSACYKAPEWYIGDQNPMLNSEGKVTVVALLQAS---UYLCLLQ-ASRLEDLRIKLESQGYFNISYIVVNHQGSPSQL 98  house mouse
NP_005401     23 DQSSLCKQPPAWSIRDQDPMLNSNGSVTVVALLQAS---UYLCILQ-ASKLEDLRVKLKKEGYSNISYIVVNHQGISSRL 98  human
XP_015223520  23 ggggRCKTPPEWAVGNEQPMTDSAGRVTVVALLQAS---ULFCLVQ-ASRLDVLRLRLEQQGLVNISYVVVNHQGEQSHR 98  spotted gar
XP_005050180  25 NSSRICHEAPAWTINGSSPMEGAAGQVTVVALLKas---uqFCLRQ-AHSLGGLRERLARQGTARVRYMIVNEKAPLSRA 100 collared flycat...
XP_005060640  19 TESQNCQEPPAWRIGEEDPMWNSRGSVTVVALLQAS---USL-CLQqASSLEDLRVKLENEGLVNISYVVVNHQGAQSQR 94  collared flycat...
XP_028917507  23 SASSHCKEAPRWQIRDQDPMLNSLGTVTVVALLQASuylCI---LQ-ASRLEDLRVKLENEGYSNISYIIVNHQGMPSQL 98  platypus
XP_002921760  23 GQSSFCKQPPAWSIRDQSPMLNSGGSVTVVALLQAS---UYLCILQ-ASRLEDLRVKLEKEGYLNISYVVVNHQGLPSQL 98  giant panda
P49907        99 KYVHLKNKVSEHIPVYQQEENQPDVWTLLNGNKDDFLIYDRCGRLVYHLGLPYSFLTFTYVEDSIKTVYCEDKCgNCSLK 178 cattle
Q98SV0       104 MYWELKRRTAQDIPVYQQSPLQNDVWEILEGDKDDFLVYDRCGYLTFHIVLPFSFLHYPYIEAAIRATYHKNMC-NCSLN 182 zebrafish
6_pfamImport  76 LHAMLAQRLSEHISLHRQDEALADVWQTLGGNKDDFFIYDRCGRLTHRISLPYAVIGHGHVEKAVKDTYCSSLCgECTHE 155
P70274        99 KHSHLKKQVSEHIAVYRQEEDGIDVWTLLNGNKDDFLIYDRCGRLVYHLGLPYSFLTFPYVEEAIKIAYCEERCgNCNLT 178 house mouse
NP_005401     99 KYTHLKNKVSEHIPVYQQEENQTDVWTLLNGSKDDFLIYDRCGRLVYHLGLPFSFLTFPYVEEAIKIAYCEKKCgNCSLT 178 human
XP_015223520  99 LYPVLKKKMSQKIRVYDQDPLQEDVWKILSGEKDDFLIYDRCGSLTHHLGLPYSMLTMSYVEDAIRDTYCKDICgNCSLE 178 spotted gar
XP_005050180 101 MLPELQRHAPPGVPVLQPEQGDPDVWQVLGGDKDDFLVYDRCGRLAFHIQLPFSFLHFPYVEAAIRYSHIKDFCgNCSFY 180 collared flycat...
XP_005060640  95 EFHLLKERVSDYITVYQQDEQQEDVWTTLNGNKDDFLIYDRCGRLVYHLGLPYSFLHFQYVEESIKIAYCENKCgNCSYT 174 collared flycat...
XP_028917507  99 NHKTLKEKVSEHIPVYQQDEKQTDVWSTLKGNKDDFLIYDrCGRLVYHLSLPYTFLSFSYVEDSIKTTYCEQNCgNCSYT 178 platypus
XP_002921760  99 KYMHLKNKVSEHIPVYQQEENQTDVWTLLNGKKDDFLVYDRCGRLVHHLGLPYSFLTFPYVEEAIKIAYCEEKCgNCSLM 178 giant panda
P49907       179 A-L-EDED-VCKNVFL-----ATKEKTAEASQRHhhPHPHSHphp------hpHPHPHPHPHPHHGhqlheNAHLSESPK 244 cattle
Q98SV0       183 A-N-FSIS-ESSDSTKndpagENNQRPNSTEPVT--AAHHHH-----------HQQHEPHHHHHNPy----PNSHKKSGD 242 zebrafish
6_pfamImport 156 T-A-ETQQ-ECTPKT--------DTQPQED---TrhECHHRHhq--------gHQHHGDGHRDHGD------NQCTHTQG 207
P70274       179 S-L-EDED-FCKTVTS-----ATANKTAEP------SEAHSH-----------HKHHNKHGQEHLG-----SSKPSENQQ 228 house mouse
NP_005401    179 T-L-KDED-FCKRVSL-----ATVDKTVET------PSPHYH-----------HEHHHNHGHQHLG-----SSELSENQQ 228 human
XP_015223520 179 S-S-SLPV-TCNSTVKpe--gKPEDKPEESPESHghPHAHGHghhhseegrqsHRRHSSHGHHHGH-----GRHHHGSQQ 248 spotted gar
XP_005050180 181 P-I-TTQE-SNST----------VEVPATPSSFPehEGMESEtp--------iHQHKPLHPHHHHE--------VSSERN 231 collared flycat...
XP_005060640 175 EpD-IDIDvVCENITK-----KAGDELSEVEPKLtgQHSHPNphr------hgHHHRRHHHHHHHKg---gRGPRRENLQ 239 collared flycat...
XP_028917507 179 M-P-EAEE-FCTNTSS-----AAKEKATEA-PLPhnDRPHHH-----------HHHHHHHG--HKP-----HPSGTEQAP 231 platypus
XP_002921760 179 --TqEAED-FCKMVSS-----ATVGTTTEAPPPHhhHHHHHH-----------HRHHHKHGHPHHG-----NDELSEDQQ 234 giant panda
P49907       245 PDtPD-TPEN-PP-PSGLhHH----HH 264 cattle
Q98SV0       243 SDvTG-KPKE-PP-HHSHqEH----VH 262 zebrafish
6_pfamImport 208 SG-PG-HDHG-HGhHGGQ-GH----HQ 226
P70274       229 PG-PS-ETTL-PP--SGL-HH----HH 245 house mouse
NP_005401    229 PGaPN-APTH-PA-PPGL-HH----HH 247 human
XP_015223520 249 EFnNG-QTQR-HS--QTH-Qqqqlikn 270 spotted gar
XP_005050180 232 TN-PS-ENHK-PA-THAH-HH----HG 249 collared flycatcher
XP_005060640 240 AA-PEpERRH-PH--SGR-RHglfgHH 261 collared flycatcher
XP_028917507 232 AD-PD-GPLRsPA-PQGL-HKrlrpag 254 platypus
XP_002921760 235 PEaEQ-AREH-PA-PRGL-HR----HH 253 giant panda
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap