Conserved Protein Domain Family
Zein-binding

?
pfam04576: Zein-binding 
Zein-binding
This domain binds to zein proteins, pfam01559. Zein proteins are seed storage proteins.
Statistics
?
PSSM-Id: 398329
Aligned: 64 rows
Threshold Bit Score: 62.1518
Threshold Setting Gi: 1002263556
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ERN01383     514 DRLKRQVEFDRKSMRALYRELEEERSASAISVNQAMAMITRLQEEKAMMQMESQQYQRMMEEQAEYDQEALQKLNDLLDK 593 Amborella trich...
XP_015636123 197 ERLRRRLAAERRRREAALEELEKERRAAASAADEAMAKIACLRNEKALVEREARQFREMAQQKQMYDRQQIESLQWVIQR 276 Japanese rice
XP_003579364 116 aDLRRLVDEGRDARSALQQELEKERSAAASAAEEAMAMILRLQKEKSTLEIEARQQRRTSDERCAFYEDEVEELRDILLM 195 stiff brome
ERN01827     417 riLGKALEEERTSRTALYNELEKERSAAATAADEAMAMILRLQEEKAVIEMEARQYQRMIEEKATYDEEERSVLKEILVR 496 Amborella trich...
EEF44232      54 rVLEQALEEEQAAHSALYLELDKERSAAATAADEAMAMILRLQGEKASIEMEARQYQRMIEEKSAYDFEEMNILKEILLR 133 castor bean
KRH66085     279 KMLENALEEEKAAYAALYLELEKERAAAATAADETMAMISRLQEEKASMELEMRQYLRIIEERVAYDEEEMDILQEILIR 358 soybean
EEF41239     133 rVLKQALEEEKAAHAALYQELEKERAAAATAADEALAMILRLQEDKASIEMEARQYHRLIEEKFVYDEEEMKILKEILVR 212 castor bean
XP_006349926 265 rfLEQALEHEREARDALCIELEKERNAAASAADEAMAMILRLQEEKASIEMDARQYQRLIEEKSAFEAEEMNILMEIVMR 344 potato
EFH68509     111 RDLEELLKEERAARAAVCVELDKERNAAASAADEAMAMIHRLQDEKAAIEMEARQFQRMVEEKSTFDAEEMVILKDILIR 190 Arabidopsis lyr...
XP_002868347 260 eILEQVLAEERAARASLALELEKERNAAASAADEALGMILRLQEEKASIEMEARQYQRMIEEKSAFDAEEMSILKEILLR 339 Arabidopsis lyr...
ERN01383     594 REKEMKDLEEEV 605 Amborella trichopoda
XP_015636123 277 FGMPCGEAEvss 288 Japanese rice
XP_003579364 196 REREARSLQKEV 207 stiff brome
ERN01827     497 REREKLVLEKEV 508 Amborella trichopoda
EEF44232     134 REKEKHFLEKEV 145 castor bean
KRH66085     359 RERENHFLEKEL 370 soybean
EEF41239     213 REKEIHFLEKEL 224 castor bean
XP_006349926 345 TEREKHFLEKEL 356 potato
EFH68509     191 REREKHFLEKEV 202 Arabidopsis lyrata subsp. lyrata
XP_002868347 340 REREKHFLEKEV 351 Arabidopsis lyrata subsp. lyrata
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap