Conserved Protein Domain Family
XhoI

?
pfam04555: XhoI 
Restriction endonuclease XhoI
This family consists of type II restriction enzymes (EC:3.1.21.4) that recognize the double-stranded sequence CTCGAG and cleave after C-1.
Statistics
?
PSSM-Id: 398312
Aligned: 7 rows
Threshold Bit Score: 322.089
Threshold Setting Gi: 503829821
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q72WR9           29 KQLESGKTDQGERAGVTAGKNMDGFVELVLDIVRANGLAHADIHQNKGLLtLPGFFRPTKLWDLLVIS--EGQLIAAVEF 106 Desulfovibri...
Q7N3K6           29 KQIESGKADQGERAGVTAGKNMDGFLALVLDIIKANGLAHAEIHQNRAMLtLPGYFRPTKLWDLLVLY--KGQLIAAIEL 106 Photorhabdus...
WP_014063815     25 EQQESEDAARGRRAEVLGGRQLDGFATVCEEILMEAGVPEKSIYFDHEAT-LPGFFRATKRWDLAVIH--EGELLAAIEF 101 halophilic a...
WP_012473590     25 qgSSTGKKDAGNRSAVTGGKHLDGFIKLLTELLAEAGLPDSAIHVKSTT--LPGYFRPTKNWDLLVVV--DRILLASIEL 100 Chlorobium p...
WP_015178493     30 AQVLAGKVDQGNRSAVTGGKQMDGFILTLTNFLLAAGVPQNHIHVKKSLTvIPGFFRPAKMYDFLVVNpeKRQLKVVIEL 109 Oscillatoria...
EIM63783         30 KQKKSGKVDYGLRGAVTGGAQMDGFIELFARLIISTGLDAHFIQRKGALD-LPGYFRPTKEWDLLVVK--DGKLIAAIEA 106 Desulfobacte...
sklmb:Mhar_0161  14 dQERRGGSDQGARSAVTGGKQMDGFVRKIIELMTASGVDEGNIYTKKTH--LPGFFRPVKGWDIVVVV--DGVLMAAIEL 89  Methanosaeta...
Q72WR9          107 KSQVGPSFGNNFNNRAEEAIGTAHDFWTAYRDGAFGEQ-PRPFIGWLMLVEDAPASRAAVQECSPHFPVFLEFKGASYIK 185 Desulfovibri...
Q7N3K6          107 KSQVGPSFGNNFNNRTEEAIGTAHDLWTAFREEAFGKQ-PRPFVGWMMMVEDASESRKSVRDSSPHFPVFEEFKGASYLK 185 Photorhabdus...
WP_014063815    102 KS-ITSSFGNNLNNRTEEALGSPTDLYTAYEEGAYDPS-PRPWLGYLMLMSENGNSTGSVRVSEPHFDVLEEFDGASYVD 179 halophilic a...
WP_012473590    101 KAHIGPSFGNNFNNRVEEALGNSTDLLTAYREGKFKPS-QKPWLGWLMLLEDAPKSTTPVRVDEPHFEVFPEFKEASYAK 179 Chlorobium p...
WP_015178493    110 KSQVG-SFGNNFNNRTEEAMGAALDIWTAYREGVFGEApPPPWLGYLFVLEDSPASRTRVQVAEPHFAVLPEFRGASYAK 188 Oscillatoria...
EIM63783        107 KSQVGPSFGNNFNNRTEEAMGSALDLWTAYREGAFHTS-PQPFLGYFFMLEDCQASTRPVRVREPHFHVFPEFKGASYMK 185 Desulfobacte...
sklmb:Mhar_0161  90 KSQVGLSFGNNFNNRTEEAMGTALDIWTAYREGAFCTS-PAPWLGYLFLLEDCPESRSPVRTQETHFPVFEEFRGASYAK 168 Methanosaeta...
Q72WR9          186 RYDILCQKLMHERLYTTASVIASPKNNCRLGQYSS 220 Desulfovibrio vulgaris str. Hildenborough
Q7N3K6          186 RYDLLCQRLVQEQLYTTAAVIAAERSAVNTGDFAE 220 Photorhabdus laumondii subsp. laumondii
WP_014063815    180 RGEQLCLRLLRQRLYDGCVFLLSDAEGGLDGEFWE 214 halophilic archaeon DL31
WP_012473590    180 RYGLFCERLMRERLYDGACLIMSDKAGGLKGKFTE 214 Chlorobium phaeobacteroides
WP_015178493    189 RYELFCQKMVRERHFTAACFLVTDREQVAQtpnyt 223 Oscillatoria nigro-viridis
EIM63783        186 RYEIFCRKLVLERHYTASAFITSNRTDGPEGIFST 220 Desulfobacter postgatei 2ac9
sklmb:Mhar_0161 169 RYELFCRKLVRERQYNAACFIIADREKSNsfesyi 203 Methanosaeta harundinacea 6Ac
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap