Conserved Protein Domain Family
Phage_holin_3_2

?
pfam04550: Phage_holin_3_2 
Phage holin family 2
Holins are a diverse family of proteins that cause bacterial membrane lysis during late-protein synthesis. It is thought that the temporal precision of holin-mediated lysis may occur through the buildup of a holin oligomer which causes the lysis.
Statistics
?
PSSM-Id: 398308
Aligned: 9 rows
Threshold Bit Score: 99.3584
Threshold Setting Gi: 312167476
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_013316567      1 MQEYEKNALGLLVLGALIALGKLLASDEKITPRLFFGRMILGSATSMAAGAALVWVPGLPPMAVTGLGAALGVAGHQAVE 80  Dickeya dada...
CAR44743          6 MDEYDHTLVSLVVVGAFIALGKMLVANEVITLRLFIGRIILGSAVSVVAGALLILWPGIHPIAVMGIGSALGIAGYQLVE 85  Proteus mira...
CBJ80147          1 MEEHEKTFVTLVLLGALIALGKMLTGHEPITLRLFVGRIILGSAVSVMAGALLIWWPGISPVAVTGIGSAMGIAGYQLIE 80  Xenorhabdus ...
utah:Sant_2538    1 MQEYEKGFVTLAMMGALIALGKMLNSNEPVTIRLVTGRVIVGSALSLMAGVALYIVPDIHPLALAGIGSALGILGLNGVE 80  Sodalis prae...
CBW74479          4 lNEHERDLLKLLTIGAIIGLGKLLVGGERICARLVFGRMIIGAALSASAGAALTVFNDLHPTALVGFASALGILGQSALE 83  Paraburkhold...
ACR69438          2 fNEHERTLFTLALIGAGSAIGRVLLSEEPITWKLFIGRTLLGSGLSMSAAALLIQYPSLSPLAVAGVGAALGVAGYQCIE 81  Edwardsiella...
WP_013318541      1 MNETDKSIVSLFIIGTLIAAGKVLASSEPITLRLFIGRVMLGGFVSMMAGIALVQFPDLSPVAINGIGAALGIAGYQTIE 80  Dickeya dada...
Q6D3X6            1 MNEAEKSVITLFVIGVLIAVGKVLAGSEPITLRLFIGRMLLGGFVSMVAGVVLVQFPNLPLTAICGIGSMLGIAGYQTIE 80  Pectobacteri...
wugsc:KPN_04876   1 MTEGEKSVLSLFVIGVLIVVGKVLAGGEPITARLFIGRMLLGGFVSMVAGVALVQFPDLPPAAVCGFGSMLGIAGYQAVE 80  Klebsiella p...
WP_013316567     81 IWLRRR 86  Dickeya dadantii
CAR44743         86 IWLRKK 91  Proteus mirabilis HI4320
CBJ80147         81 VWLRKR 86  Xenorhabdus bovienii SS-2004
utah:Sant_2538   81 AWLRKK 86  Sodalis praecaptivus
CBW74479         84 AVVQKC 89  Paraburkholderia rhizoxinica HKI 454
ACR69438         82 IYLRRW 87  Edwardsiella ictaluri 93-146
WP_013318541     81 LLIQRR 86  Dickeya dadantii
Q6D3X6           81 LLIQRR 86  Pectobacterium atrosepticum
wugsc:KPN_04876  81 IAIQRR 86  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap