Conserved Protein Domain Family
Anoctamin

?
pfam04547: Anoctamin 
Calcium-activated chloride channel
The family carries eight putative transmembrane domains, and, although it has no similarity to other known channel proteins, it is clearly a calcium-activated ionic channel. It is expressed in various secretory epithelia, the retina and sensory neurons, and mediates receptor-activated chloride currents in diverse physiological processes.
Statistics
?
PSSM-Id: 398306
Aligned: 324 rows
Threshold Bit Score: 132.348
Threshold Setting Gi: 124460065
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_020824995  240 ICDYFGVKIAMYFAWLGFYTSAMVYPAVFGSV---------------LYTft--eaDQ-------TSRdiCCVIFAI-FN 294  koala
A0DHW5        686 ICSYFGEKIGLFLEFTTHHILCYSVLSILGFLftiamitskeldkqtYTA--------------------IISIFSL-LV 744  Paramecium te...
A0C5J6        679 ICIYFGEKIGLYFKFSSYYIQFSTIMAALGVIfnmimystniqhndiSLV--------------------AQSIFSI-LI 737  Paramecium te...
A0CHM6        689 ICLYFGEKVGLYFEFTSYFIKFSTPMAAFGLLfsvllytsqdydnevYTA--------------------TMSVFSI-LL 747  Paramecium te...
A0CY40        679 ICSYFGEKIGLYFEFTSYFIKFSTPMAALGLLfsvlmyisqnynnevYTA--------------------TVSVFSI-LI 737  Paramecium te...
A0DTP9        676 lCQYFGESVGTYFYFLCFFSQMLLYQNCLGLL---------------YYLiq----------------ipSKIIYLVfQL 724  Paramecium te...
XP_001028021  847 ICEYFGERIALYFTFQSFYFKAQFSVALLSTP---------------IFIvyeyfgQTdkg-lgaQ----IAGLIHIfIV 906  Tetrahymena t...
A0DBP1        583 ICSYYGERIALYFMFLQFFVHELLPISYFGIL---------------TFIvqilydVEala--nkV----SIIFFTI-MI 640  Paramecium te...
XP_004360577  168 ANRYFGEEISFYFLFLNFYNFGLFLLSLFGIP-------------------------VsiiqyvtDPYmiSGALFAV-LM 221  Cavenderia fa...
Q55GA1        227 IKDYFGEEVTFYFLFLRFYNVGLGIVSLFGLA-------------------------VaivsytrDSYkfASSSFSI-AL 280  Dictyostelium...
XP_020824995  295 VIWSTLFLEEWKRRGAEFAYKW----GTldTPGE----AIE-------------EPRPQFRGV-RRI------------- 339  koala
A0DHW5        745 VLWNSFVTDYWKTTQIKFNIRQ----GF----NKraqeKLI---------------LMSFKGQyIRSv------------ 789  Paramecium te...
A0C5J6        738 INLNCFLTDYWNQTQFAFNIQN----GQ----NNnykyNLI---------------RSSFKGEqIRSi------------ 782  Paramecium te...
A0CHM6        748 VHWSSFQTDCWYQQQLTFNLKF----GQ----NRdvkeSII---------------RSSFKGQnIRSi------------ 792  Paramecium te...
A0CY40        738 VHWNSFQTDCWHQQQLTFNLKF----GQ----NRnvkeSII---------------RSSFKGQnVRSi------------ 782  Paramecium te...
A0DTP9        725 QI-TSLYTSKWEQQLKIFNQSF----GI----------NSQedidttsnkqigePKRSLIN------------------- 770  Paramecium te...
XP_001028021  907 VIWSNVFYGQWTYREAEFSLKYnqsqSG----------EDEed------------iRPGFRGEyERS------------- 951  Tetrahymena t...
A0DBP1        641 VFWSSTFQALWIRQEMQFQTMF----GL----EDmelnQVE---------------LIGFVGKpKRSi------------ 685  Paramecium te...
XP_004360577  222 CIFSSFFLEVWKRFQSIYAWNW----HS--NDFR----DGE-------------QALPSYKTShNKIgvyhsdifltkkd 278  Cavenderia fa...
Q55GA1        281 AVLSTLFFEIWKRYGSIYSWKW----DQ--EDYI----DDE-------------EQLPSFKPGnFSEgvyhkgiflkskh 337  Dictyostelium...
XP_020824995  340 ---------------SpVtnveefYYPPWKr-------LLFQLLVSLP--VC-----ATCL---IGGF--LLMLgcfqlq 385  koala
A0DHW5        790 --------------eN----------DELNslgssqaqIISKLIISI---FIlilliG------SDFG--VIIAkfnefn 834  Paramecium te...
A0C5J6        783 --------------sT----------DQLNftgiihfqFFWRISISI---FVlilifG------SDVC--ITIGlyffnl 827  Paramecium te...
A0CHM6        793 --------------eN----------DQLNsigvihskFIQRLIISI---FIlifliG------SDIG--IFVGlyyfnl 837  Paramecium te...
A0CY40        783 --------------eS----------DELNsigvihskFIQRLVISI---FIlifliG------SDIG--RIIGlyffnl 827  Paramecium te...
A0DTP9        771 --------------------------DQMNvpsineldQIFRECVSM---LIfillqL------LYSVifIALYflcawf 815  Paramecium te...
XP_001028021  952 ---------------I----------TSNKlndysydrRLTEKSERNYwiLIffiliV------NIVIiyALIYlqsyfd 1000 Tetrahymena t...
A0DBP1        686 --------------aN----------DKLNdlqysskeTWFKFFFNM---ILvaiflV------IEIV--IIVAlqllsl 730  Paramecium te...
XP_004360577  279 ftenelelvepymtdI-Py----mSKKRSRt-------KSLKMTFTFT--VVt---vLVLLvamSTIA--IFSLrivlka 339  Cavenderia fa...
Q55GA1        338 f-gkkvkyvqknittR-Py----lTSYQQKm-------KLLKTIGTFS--VVv---tLVLIvpiFTIS--IFTLriales 397  Dictyostelium...
XP_020824995  386 elvlsvkglpr----lvrflpkiglallvsaS-A---EAYKKLA----YWLNDMENYRLQSAYEKHLIVKIVLFQFVNSY 453  koala
A0DHW5        835 nkfynlei----------iissslnfgiqklIeQ----YYEQIA----TFLTDFENLQISNQYETSYTIKKYTLYSLSGL 896  Paramecium te...
A0C5J6        828 ylesifastsiqfrnfeiivtailnyviqiiVeY----YYESIA----IVLTDFENFQTVEHYENSYCLKKYALICFSQL 899  Paramecium te...
A0CHM6        838 ylktklddlgndfqyfevivtaslnyiiqlvIdQ----FYEQIA----TILTDFENFQTSYQYETSYIIKKYTLYCFSQL 909  Paramecium te...
A0CY40        828 ylksefidlgnyfqyfeiivtaslnyviqllIsS----FYEQIA----TILTDFENFQTSYQYETSYIIKKYTLHCSSQV 899  Paramecium te...
A0DTP9        816 qslfkqt-----------tainnseiiiiaiLhlglnkLYTFHAqktiQQLVDFEQQRTIQAVKLSYNLKLYSFSIIQQL 884  Paramecium te...
XP_001028021 1001 dhntidsgktf----mglnifiptiilefifWvEe--FLFKKFA----LFTCREANFKTTKEFEQSYSTKLFTFIFFNHL 1070 Tetrahymena t...
A0DBP1        731 ylennpdvpniefielsvfipaliwvfigilLdN----IYRPVA----FFLTKWENHKYLSQFETSFIIKNLLFSTVNRL 802  Paramecium te...
XP_004360577  340 iqeqligt----------slgsvisacfiqlF-N---YVYRMLA----YWLTRYEGHRIQSTFNQSLTVKLFLFQFVNTF 401  Cavenderia fa...
Q55GA1        398 ienktves----------gigsvinalfilfF-N---FIYKNIA----YFLTKFESHRVASSFNASYSTKLFLFQFVNSF 459  Dictyostelium...
XP_020824995  454 LSLFYIGFY-------------LK--------------------DMERLK-EMLATLL---IT-----RQFL-------- 483  koala
A0DHW5        897 FPLLVIQFLnspfyly-----------------------cweescKNEIQ-YFFATTIfwiFT-----LQFI-------- 939  Paramecium te...
A0C5J6        900 FPLLILCFLngelnlk-----------------------csqnncIGQAQ-YFFGTTLlltIInvkrrIQQI-------- 947  Paramecium te...
A0CHM6        910 IPLLMISFLhsplgly-----------------------ckdencQHNVE-YYFGTTMmwiFL-----MQVI-------- 952  Paramecium te...
A0CY40        900 VPLLMVSFLnsplqly-----------------------ckeencRHNVE-YYFGTTMmlmFL-----MQVI-------- 942  Paramecium te...
A0DTP9        885 GPLLILRFFnhsfqlvcqsdscEQyigyy----------fltyiIIKSVE--KLCVFL----------FNFYslrrqplf 942  Paramecium te...
XP_001028021 1071 VPPTLISFIidqnigcvqddcsYH--------------------LSVYIRsYQYIIVF----------KSIV-------- 1112 Tetrahymena t...
A0DBP1        803 GQPFIIAFFyeqtigc-----------------------vndnycySQLQ-IYMRVVFiieFG----------------- 841  Paramecium te...
XP_004360577  402 SGLFYIGFVkdn-------velWGdkgledtcsysnrlpglwkgCVTDLE-FQIFSI----IL-----VNFF-------- 456  Cavenderia fa...
Q55GA1        460 SGLFYIAFLknn-------vylWGdidledtcstpnkidglwkgCTEDLQ-FQLFSI----LA-----VNFI-------- 514  Dictyostelium...
XP_020824995  484 -----QNIR-EVL--------QPHL-YRRLTSGdlsartlwefsktflkllthrppvpeaqpreplagppepraqegsgs 548  koala
A0DHW5        940 ----------KYFrly-------fkvKEQF-------------------------------------------------- 952  Paramecium te...
A0C5J6        948 ----------K---------------EKS--------------------------------------------------- 951  Paramecium te...
A0CHM6        953 ----------RFLktffhelvKS---PQK--------------------------------------------------- 968  Paramecium te...
A0CY40        943 ----------KFLmtfqndmvKN---PQK--------------------------------------------------- 958  Paramecium te...
A0DTP9        943 iykfqQHDInEYIev----------------------------------------------------------------- 957  Paramecium te...
XP_001028021 1113 ----------EII--------YP---LLRSSLNnvtq------------------------------------------- 1128 Tetrahymena t...
A0DBP1        842 -----KHILfGFI--------FP---IIKQIYQrary------------------------------------------- 862  Paramecium te...
XP_004360577  457 -----SGIFtELI--------LPKLiVYVN-------------------------------------------------- 473  Cavenderia fa...
Q55GA1        515 -----ASIFsELL--------GPWIqYYIK-------------------------------------------------- 531  Dictyostelium...
XP_020824995  549 ggrkclnggcgvpeeeeeerrrrigeggeeaggggggeeddeededdeeeddeeeslldcglklrkvsfaeraerqrrag 628  koala
A0DHW5            --------------------------------------------------------------------------------      Paramecium te...
A0C5J6            --------------------------------------------------------------------------------      Paramecium te...
A0CHM6            --------------------------------------------------------------------------------      Paramecium te...
A0CY40            --------------------------------------------------------------------------------      Paramecium te...
A0DTP9            --------------------------------------------------------------------------------      Paramecium te...
XP_001028021      --------------------------------------------------------------------------------      Tetrahymena t...
A0DBP1            --------------------------------------------------------------------------------      Paramecium te...
XP_004360577      --------------------------------------------------------------------------------      Cavenderia fa...
Q55GA1            --------------------------------------------------------------------------------      Dictyostelium...
XP_020824995  629 ptgpeslleegsptmvdkgldpaavfALCEDEEdaeepsdspgrepleapggprgerpggegrdqgpgddeaealgpged 708  koala
A0DHW5        953 ----------------------------HINQQiq--------------------------------------------- 959  Paramecium te...
A0C5J6        952 ------------------------------YSS----------------------------------------------- 954  Paramecium te...
A0CHM6        969 -----------------------------LYPYn---------------------------------------------- 973  Paramecium te...
A0CY40        959 -----------------------------LYPNn---------------------------------------------- 963  Paramecium te...
A0DTP9            --------------------------------------------------------------------------------      Paramecium te...
XP_001028021 1129 ----------------------lvkqLVNKDVDqkqq------------------------------------------- 1143 Tetrahymena t...
A0DBP1        863 -----------------------gfvSIVDFGGslqk------------------------------------------- 876  Paramecium te...
XP_004360577  474 ----------------------------KIKGH----------------------------------------------- 478  Cavenderia fa...
Q55GA1        532 -----------------------------IIRQ----------------------------------------------- 535  Dictyostelium...
XP_020824995  709 krrkqnrtsWIDPPEedySPQLtqaeL--ES-CMKRYEdpF-Q----DYQEMFV--------QFGYVVLFSSAFPLAALC 772  koala
A0DHW5        960 -------ntDSLLQLiqdQNSKvpfwRssEK--DGIV-----D----EYMEFFL--------FSTLINLFGCVFPLSVTF 1013 Paramecium te...
A0C5J6        955 ---------KNLLTFienQESKtpfqQtqEK--YGII-----D----EYMKFFL--------LSTLINMFGGLFPLSFTL 1006 Paramecium te...
A0CHM6        974 --------hSTLCDFienQEKRipfqKsiEK--YGNI-----D----DYMDFFL--------QLTLTNIFGCLFPFSITL 1026 Paramecium te...
A0CY40        964 --------qQSLCDFieiQEQRipfqKsvEK--YGNI-----D----EHMDFFL--------QLTLINIFGCLFPFSVTL 1016 Paramecium te...
A0DTP9        958 -----------------qSKKPsn----------------ikD----QYFNCIEenlqqnmvELTILTYFAYIYPITYFM 1000 Paramecium te...
XP_001028021 1144 -----ylfdHVNIEIenqSGLMdsviDeiDQpT---------R----DYIEMFTyycfnvtyGFGFPLVFAITFG----I 1201 Tetrahymena t...
A0DBP1        877 -----ktpyYHFNKSieaETQKes-------ftIDQV-----DgtiwEYLELNL--------QFALLANFGSPFPLIFIT 931  Paramecium te...
XP_004360577  479 -----------TKFSkksSLpc---eE--QF-YLPKFD--TfD----EFNEIII--------QFALISMFAGVLPFSPLL 527  Cavenderia fa...
Q55GA1        536 -----------KPTGfr--eKIepfeQ--QF-YRDTFD--TfQ----EFNQIII--------QFSYISMFSAASPISPII 585  Dictyostelium...
XP_020824995  773 ALVNNLIEIRSDAFKLCTGLQR--PFGQRV-DSIGQWQKVMEAMGILAI------VVNCYLIgqcgqlqRLFPW--LS-- 839  koala
A0DHW5       1014 FWIWMILQVQILKLRLCYQLQR--PWPKNE-GSLGVWDDLNQLINLVAI------LSNSGITs---------iYykSR-- 1073 Paramecium te...
A0C5J6       1007 FWIWMILQFQIVKFKLLYQIQR--PWPKGD-SSLGIWFEIHQFINFISL------LSNCSLIc---------vYyyKY-- 1066 Paramecium te...
A0CHM6       1027 FWIWNILQVQISKLKLLFLFQR--PWPKGD-GSLGIWDDFYQLINFVTL------LCNSGLIc---------iYyyDK-- 1086 Paramecium te...
A0CY40       1017 FWIWTILQVQISKLRLLYISQR--PWPKGD-GSLGIWDDFFQLINYMTL------LSNTGLIc---------mYyyET-- 1076 Paramecium te...
A0DTP9       1001 QWLLFVVQIYADKAQYLYYYQRpwP---QIdCFVKVWNNILQYIILSSViitsygLSNSLVF------------------ 1059 Paramecium te...
XP_001028021 1202 TFIKMIVTRRLF----TRRIKR--PNPQNA-STIGIFRQFMNLGSSLSI------LTYTGIFcft------rsQkpDW-- 1260 Tetrahymena t...
A0DBP1        932 GLAMNYLELFLDKFKLIWLTKR--PTPQTA-RTIGPFVYYMNLISYISI------FINSGLLsy--------sNqdVF-- 992  Paramecium te...
XP_004360577  528 ALINNIFENKIDAYKLCYSHRR--PTYKGS-NGIGHWYRFLVLIGVFSV------ITNSLFI-------GFSFptllkft 591  Cavenderia fa...
Q55GA1        586 SFFHNIFEERVDSYKLINSLRR--PNYNGS-NGLGSWFFIIVLVGMFSV------LTNVLLI-------GFSFptllyft 649  Dictyostelium...
XP_020824995  840 -PEAAIISVVV-LEHFALFLKYLIQAAIPDIPAWVAEEMAKL 879  koala
A0DHW5       1074 -LLDDIILLFLsLLFYHFLIKCITLGIFGNTPRIMQQIIQRG 1114 Paramecium tetraurelia
A0C5J6       1067 -LQDDVIQLFVtLLFYNFFIKYITNTTFLSPPLILEYIVKRG 1107 Paramecium tetraurelia
A0CHM6       1087 -LHDQIIILFLgLLFYNFFIKYLTNSIFGNSPIILDQIVKRS 1127 Paramecium tetraurelia
A0CY40       1077 -MKDQVIILFLaLLFYNFFIKYLTNSIFGNSPIILDQIVKRS 1117 Paramecium tetraurelia
A0DTP9       1060 -QDKSQIFVFVsFMLLSYTMNFVYQVWYSETPSYLQK----- 1095 Paramecium tetraurelia
XP_001028021 1261 -GPFTQLNAFMfISFFFFVVKFFIDRYYSELDSKTMDILKRQ 1301 Tetrahymena thermophila SB210
A0DBP1        993 -TEINSFTLFAiLMIAFFLFKFVTDIIYGNTDSSAELVRQRH 1033 Paramecium tetraurelia
XP_004360577  592 ndpytiLWTVViLEHMILMFKWVVSALIPDQTHLVRKMKSIH 633  Cavenderia fasciculata
Q55GA1        650 dspynvLWIVFiLEHLVILTKVVLAKAIPDETKKLKKKKASL 691  Dictyostelium discoideum AX4
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap