1RP3,6DVE,4NQW


Conserved Protein Domain Family
Sigma70_r4

?
pfam04545: Sigma70_r4 
Click on image for an interactive view with Cn3D
Sigma-70, region 4
Region 4 of sigma-70 like sigma-factors are involved in binding to the -35 promoter element via a helix-turn-helix motif. Due to the way Pfam works, the threshold has been set artificially high to prevent overlaps with other helix-turn-helix families. Therefore there are many false negatives.
Statistics
?
PSSM-Id: 398304
Aligned: 111 rows
Threshold Bit Score: 45.8871
Threshold Setting Gi: 28851850
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1RP3_C 185 VSKLPEREKLVIQLIFYEELPAKEVAKILETSVSRVSQLKAKALERLRE 233 Aquifex aeolicus
Q9AAF3 147 MQTLNPDQSQAIEMAFFQEQTHSQISEALGVPLGTVKARIRFGMMKLRA 195 Caulobacter vibrioides
Q9KF66 115 LSELKPEETTLLVLRYYHDFTILEIARFMNKPEGTIKAQLHRTLAKVRK 163 Bacillus halodurans
P94370 125 FSKLDPKLRTPVLLRHYYGYTYAEIGVMLQIKEGTVKSRVHKGLQQIRK 173 Bacillus subtilis subsp. subtilis str. 168
Q9A3F1 124 LASLPQRQRMLVSDVKLTGLSLAEAGARAGISEGAAKVALHRALKALAE 172 Caulobacter vibrioides
Q1D507 115 LQQLHPDHREAVVLSKVEGWSFEEIGALRGISPGAARLRAHRGYEKLRE 163 Myxococcus xanthus DK 1622
Q73WV3 187 LDSLPPEFRAAVVLCDIEGLSYEEIGATLGVKLGTVRSRIHRGRQALRD 235 Mycobacterium avium subsp. paratuberculosis
Q9K7Z1 127 LKQIPTEQREAIIRSYFRGETHSEIATTMDKPLGSIKSLIRYGLNNLRK 175 Bacillus halodurans
Q9I2W5 109 LVHVNPIDREILVLRFVAELEFQEIADIMHMGLSATKMRYKRALDRLRE 157 Pseudomonas aeruginosa
Q9AD34 173 LARLTPDQWECLRLRYWDNLPFCEVGQRMDRSTGAAKILKDRALRSLSA 221 Streptomyces coelicolor
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap