Conserved Protein Domain Family
DER1

?
pfam04511: DER1 
Der1-like family
The endoplasmic reticulum (ER) of the yeast Saccharomyces cerevisiae contains of proteolytic system able to selectively degrade misfolded lumenal secretory proteins. For examination of the components involved in this degradation process, mutants were isolated. They could be divided into four complementation groups. The mutations led to stabilisation of two different substrates for this process. The mutant classes were called 'der' for 'degradation in the ER'. DER1 was cloned by complementation of the der1-2 mutation. The DER1 gene codes for a novel, hydrophobic protein, that is localized to the ER. Deletion of DER1 abolished degradation of the substrate proteins. The function of the Der1 protein seems to be specifically required for the degradation process associated with the ER. Interestingly this family seems distantly related to the Rhomboid family of membrane peptidases. Suggesting that this family may also mediate degradation of misfolded proteins (Bateman A pers. obs.).
Statistics
?
PSSM-Id: 398288
Aligned: 8 rows
Threshold Bit Score: 204.119
Threshold Setting Gi: 74626345
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q99J56  11 IPAITRYWFAATVAVPLIGKLGIISPAYFFLWPEAFLYRFQIWRPFTATFYfpvgPGTGFLYLVNLYFLYQYSTRLEAGA 90  house mouse
Q9Y7Y0  16 IPPVTRYILLGTAATTILTLCQLLSPSMLVLHYPLVVRQKQWYRLFTNYLY----AGTGFDFIMNIYFFYQYSTYLENFV 91  Schizosaccharomyces p...
Q9VQ57  10 LPRFTRYWLTATVVLSMLCRFDVIPLHWLHLDRSAVFSKLQLWRCMTSLFVfpisSNTAFHFLINCFFIVQYSSKLEKDQ 89  fruit fly
Q93561  10 IPIVTRYWFLASTIIPLLGRFGFINVQWMFLQWDLVVNKFQFWRPLTALIYypvtPQTGFHWLMMCYFLYNYSKALESET 89  Caenorhabditis elegans
Q21997  11 MPPVTRFYTGACVLLTTAVHLEFVTPFHLYFNWELIIRKYQFWRLITSFCFf---GSFGFSFLFNMIFTYRYCMMLEEGS 87  Caenorhabditis elegans
Q9D8K3  13 VPAVTRAYTAACVLTTAAVQLELLSPFQLYFNPHLVFRKFQVWRLITTFLFf---GPLGFGFFFNMLFVFRYCRMLEEGS 89  house mouse
Q9VEU2  11 IPVVTRAYTTVCVLTTLAVHLDLVSPLQLYFNPTLIVRKFQIWRLATTFLYf---GTIGISFFFNMVFTYRYCRMLEDGS 87  fruit fly
Q12743  30 IPPITRTLFTLAIVMTIVGRLNLINPWYFIYVWNLTFKKVQIWRLLTSCVMl---SSRAMPALMELYSIYDRSSQLERGH 106 Saccharomyces cerevis...
Q99J56  91 FDGR---------PADYLFMLLFNWICIVITGLam----dmQLLMIPLIMSVLYVWAQLNRDLIVSFWFGTRFKACYLPW 157 house mouse
Q9Y7Y0  92 FARN---------AKKYIIYLVKVALLIDAFSLisg---lgSALNQSLAAAIAYNWSLFNSFSKIQFLFGFHVQGKYLPY 159 Schizosaccharomyces p...
Q9VQ57  90 YSRS---------PADYLYLLIVSAVLANIGGMif----nvYFLMDTLVLAITYIWCQLNKDVTVSFWFGTRFKAMYLPW 156 fruit fly
Q93561  90 YRGR---------SADYLFMLIFNWFFCSGLCMal----diYFLLEPMVISVLYVWCQVNKDTIVSFWFGMRFPARYLPW 156 Caenorhabditis elegans
Q21997  88 FRGR---------RADFVYMFLFGAVLMILSGIfv----qiLFLGQAFTIMLVYIWSRRNPMIQMNFFGVLTFTAPYLPW 154 Caenorhabditis elegans
Q9D8K3  90 FRGR---------KADFVFMFLFGGVLMTLLGFlg----slFFLGQALMAMLVYVWSRRSPHVRVNFFGLLNFQAPFLPW 156 house mouse
Q9VEU2  88 FRGR---------SSDFVMMFIFGGVLMTFFGIfv----nlLFLGQAFTLMLVYVWSRRNPLVPMNFFGVLNFQAPYLPW 154 fruit fly
Q12743 107 FGPGlsnrrgpmvTVDYAYYLCFCILAITTATTiiygsyypVVLTSGFISCITYTWSIDNANVQIMFYGLIPVWGKYFPL 186 Saccharomyces cerevis...
Q99J56 158 VILGFNYIIGG-SVI-NELIGNLVGHLYFFLmfrypm--------------dlggrNFLSTPQ 204 house mouse
Q9Y7Y0 160 VLLGFSFLTGGlPSLvVLGFGIISAMIVNFF-------------------------DSIHTPV 197 Schizosaccharomyces pombe 972h-
Q9VQ57 157 VLAAFEFIFHF-SL--ASLVGIFVGHVYYFFkfqysq--------------dlggtPLLETPQ 202 fruit fly
Q93561 157 VLWGFNAVLRG-GGT-NELVGILVGHAYFFValkyp---------------deygvDLISTPE 202 Caenorhabditis elegans
Q21997 155 VLLLFSLLLGN-NAV-VDFMGIACGHIYFFLedvfpf--------------qehgkRFLKTPQ 201 Caenorhabditis elegans
Q9D8K3 157 ALMGFSLLLGN-SVV-TDLLGILVGHIYYFLedvfpn--------------qpggkRLLLTPS 203 house mouse
Q9VEU2 155 VLLCCSMILGN-TVW-VDVIGMGVGHIYYVLedvypt--------------lsngyRLIKTPY 201 fruit fly
Q12743 187 IQLFISFVFNEgDFV-ISLIGFTTGYLYTCLdthtlgpiwgmisrkadptygispngkFSTPW 248 Saccharomyces cerevisiae S288C
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap