4BIG,4EG9


Conserved Protein Domain Family
DUF576

?
pfam04507: DUF576 
Click on image for an interactive view with Cn3D
Csa1 family
This family contains several uncharacterized staphylococcal proteins. These proteins have been called conserved staphylococcal antigens (Csa).
Statistics
?
PSSM-Id: 398286
Aligned: 15 rows
Threshold Bit Score: 304.686
Threshold Setting Gi: 122540339
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4BIG_A    20 KEAEIKKSFEKTLSXYPIKNLEDLYDKEGYRDDQFDKNDKGTWIVNSQXAIQN-KGEALKIKGXLLKIDRNTRSAKGFYY 98  Staphylococcus aure...
Q5HK97    32 KEEKIKKGFEKTLGMYPIKNLEDLYDKEGYRDEEFDEGDKGTWILYSEMVIQR-KGDDLVTRGMILKVNRNTRTSKGNYI 110 Staphylococcus epid...
Q5HK99    32 KETEIKKSFNKTLSMYPIKNLEDLYDKEGYRDEEFNKNDKGTWVITSSINIQQ-KGEGLKTRRMVLFMNRNTRTSKGKFM 110 Staphylococcus epid...
Q2G1P8    28 KEAEVKKSFEKTLSMYPIKNLEDLYDKEGYRDDEFDKNDKGTWIIGSEMVVQP-KGERMKSKGMVLYMNRNTKTTTGKYI 106 Staphylococcus aure...
Q5HK85    32 KETEIKKSFNKTLSMYPIKNLEDLYDKEGYRDEEFDKDDKGTWLLHSEMAIQR-KGEDLETRGMVLKINRNTQTSKGDYI 110 Staphylococcus epid...
4EG9_A    28 RNAQIKDTFNQTLKLYPTKNLDDFYDKEGFRDQEFKKGDKGTWIVNSEXVIEP-KGKDXETRGXVLYINRNTRTTKGYYF 106 Staphylococcus aure...
Q2FVC4    32 KDKQIKENFNKTLSLYPTKNLEDFYDKEGFRDQEFEKGDKGTWIIHSKMTIET-NGKNMESRGLVLYVDRNTRTTKGEFI 110 Staphylococcus aure...
Q2G0X1    34 KEEQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSN-KQGGLSNEGMVLYLDRNTRTAKGHYF 112 Staphylococcus aure...
Q2G0W9    42 KEEQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGTWTILTGFSKSN-KPGVLDDEGMVLYLNRNTKKATGYYF 120 Staphylococcus aure...
EFI83943  18 KAEKTEQSFEKVLAMYPTKNLEAFYDMEGYRDDEFEKGDKGVWVLNSEMSISTsKKDPLHTEGMLLRINRNTHTAKGYYY 97  Listeria grayi DSM ...
4BIG_A    99 TNEIKTEKYEVAQDNQKKYPVKXINNKFISTEEVKEENIKKEIENFKFFAQYSNFKDLXNYKDGDISYNPEVPSYSAQYQ 178 Staphylococcus aure...
Q5HK97   111 INKISTDSKGVSRNTQKKFPVKMENNKIIPIKKIEDSKIKREIDEFKFFAQYANFNSLKDYKNGDIATNPKVPSYSAEYD 190 Staphylococcus epid...
Q5HK99   111 ITEVKEKSDIGFQTRKKEYPVKLIDNKFIPSKQIKDEKIKKEIENFKFFSQYGNFKDLKDYKDGEVSYNPNAPNYSAKYQ 190 Staphylococcus epid...
Q2G1P8   107 VSETLHDEDGRPKSKDKEYPVKMVDNKIIPTKGIKDENIKKEIENFKFFAQYGSFKDLSKYKDGDISYNPEVPSYSAKYQ 186 Staphylococcus aure...
Q5HK85   111 TNKITYDNKGRPQSNKKKYPVKMENNKIIPIKKIEDSKINREINEFKFFAQYANFKELKDYKNGNISYNPNVPSYSAEYD 190 Staphylococcus epid...
4EG9_A   107 ISEXTDDSNGRPKDDEKRYPVKXEHNKIIPTKPLPNDKLKKEIENFKFFVQYGNFKDINDYKDGDISYNPNVPSYSAKYQ 186 Staphylococcus aure...
Q2FVC4   111 VRELWEDKKGYSRSKEKEYPVKMEHNKIIPTKPIADDKLRKEIENFKFFVQYGDFKDINDYKDGDISYNPNVPSYSAKYQ 190 Staphylococcus aure...
Q2G0X1   113 VKTFYNKGK---FPDRKNYKVEMKNNKIILLDKVEDTNLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFK 189 Staphylococcus aure...
Q2G0W9   121 VNKVYDDISK--NHNEKKYRVELKNNKIVLLDNVEDKKLKQKIENFKFFSQYADFKDLKNYQDGNITTNENVPSYEAQYK 198 Staphylococcus aure...
EFI83943  98 LDTTNEEKL--DENNEKKYPVTYDENGFHLVKAVSDPKLREKIENFQFFVQYGEFKQLNQYKNIDKMYNPEVPMYELEYQ 175 Listeria grayi DSM ...
4BIG_A   179 LTNDDYNVKQLRKRYDIPTNKAPKLLLKGTGNLKGS--SVGYKKIEFTFLENKNENIYFTDSLHLEPS 244 Staphylococcus aureus subsp. au...
Q5HK97   191 LENSDYNVKQLRKRYDIPTQQAPKLLLKGTGDLKGS--SIGSKDIEFTFIEKPKKNIYFSDSLDYKPS 256 Staphylococcus epidermidis RP62A
Q5HK99   191 LSNNDYNVKQIRKRYDIPTEQAPKLLLKGTGDLKGS--STGSKNIEFTFVEKKGENIYFTDSVEYTPS 256 Staphylococcus epidermidis RP62A
Q2G1P8   187 LTNDDYNVKQLRKRYKIPTNKAPKLLLKGSGDLKGS--SVGYKDIEFTFVEKKGENTFFTDSLHLEPS 252 Staphylococcus aureus subsp. au...
Q5HK85   191 LENTDYNVKQLRERYDIPTKQAPKLLLKGTGDLKGS--SIGTKDVEFTFVKGKQENIYFSDSMNFMPS 256 Staphylococcus epidermidis RP62A
4EG9_A   187 LNNDDYNVQQLRKRYDIPTKQAPKLLLKGDGDLKGS--SVGSRSLEFTFVENKEENIYFTDSVQYTPS 252 Staphylococcus aureus subsp. au...
Q2FVC4   191 LSNDDYNVKQLRKRYDIPTKKAPKLLIKGDGDLKGS--SIGHKNLEFTFIENKEENIYFTDSINFKPT 256 Staphylococcus aureus subsp. au...
Q2G0X1   190 MSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGS--SVGYKKLEIDFSKGGKSDLSVIDSLNFQPA 255 Staphylococcus aureus subsp. au...
Q2G0W9   199 MNNSDKNVKKLREIYPITTNNSPNLKLYIDGDIKGS--SVGYKKIEYKFSKDKGQETTLRDYLNFGPS 264 Staphylococcus aureus subsp. au...
EFI83943 176 LTNDDPNVKQLRKRYEIPTDKETILLLKGRGNLDGSsgSVGYKNIEFTFD--KKVDNYFTDSIDYQPA 241 Listeria grayi DSM 20601
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap