Conserved Protein Domain Family
Rft-1

?
pfam04506: Rft-1 
Rft protein
Statistics
?
PSSM-Id: 398285
Aligned: 32 rows
Threshold Bit Score: 396.986
Threshold Setting Gi: 74966806
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CCD23329      22 KSTKGATFLMLGQLFTKLITFFLNSLLVR--FLSPRIFG-ITAFLEFIVNTVLFFSREAIRLSTLRITEDhtts------ 92  Naumovozyma dai...
ERN16275      11 alihtfFYLIASQVISRALSFLLNLLIAR--QLTEVDYAlYAIQFHLLVTTILFLSREGFRRACMRTELWde-------- 80  Amborella trich...
NP_196380     99 nlsrifKFSLSRQFISRSIPFVFNSWIVR--HLTERDYAlYAIQFHLFVTCVLFLSREGFRRACLRAGTKrd-------- 168 thale cress
Q23444         2 SLFSSLVHNVRGQLIARIISFAINMYLLR--RINNDVLGlVNVRLTLLYSSILFLTREPLRKA----------------- 62  Caenorhabditis ...
XP_011674796  12 SSARSASYNMVLQVMFRVLTFMLNAFIIKygYVHEDMLGvVNVRLMLLYSTILFIAREAFRRACLS-------------- 77  purple sea urchin
EFX76726       9 GSIKSASYNMILQVAFRVITFVLNGLVLH--NVDKDVLGiLNVRLMLLIMTILFVSREAFRRACMS-------------- 72  common water flea
EFN65476       8 SSLENASFSIIFQIFCRCITFLLNAFVVR--HVGQAILGvINVRLLLLESMILFLSREPFMKACLT-------------- 71  Florida carpent...
Q9Y123         8 SSLLGAGFSIIFQILCRILTFGINAYIVR--HVGREVLGiMNVRLLLLESTLLFLSREAINRAALSANAQ---------- 75  fruit fly
Q6C6S3       102 TSAAGATLLIGIQILSKLASFGLNQMLLL--VATPALFG-ANAQLEFVLNTVLFFSREAVRLALQRLTLAgkkpdvyvfg 178 Yarrowia lipoly...
EMD39779      10 atLTSASFLVLLQLFSRLFTFILNQALVR--LVSPQVFGtAAIQFELLLSTILFLSREGVRNALLRAPSSgq-------- 79  Gelatoporia sub...
CCD23329      93 -svekTKNSQILQTAVNFAYIPFVIGVPLSIVLT---TWQ--YKNINGYFINLPFFQVSILL-IWISIIVELLSEPFFII 165 Naumovozyma dai...
ERN16275      81 -----gSMEENGSKLLAVAWITVPIGFLLTIAACsfvLWW--QSLNLSGK-----YAQAVLI-HGFACILEILAEPLYIL 147 Amborella trich...
NP_196380    169 ----gPESEENVTRILKVAWVTVPLGIAITIAACifvLWW--QNLSYSDP-----YAQAIWI-HGFACVLELMAEPLYIL 236 thale cress
Q23444        63 -----EIIRGSLPKFINLLWLSPIISTVISVVCVy--LWYafSSTSDE-------VSWSVLLsFPISAIIESIAEPFSVI 128 Caenorhabditis ...
XP_011674796  78 -----QSSKHYWPQVINLLWCSLPLGVVCATILSy--VWI--ALLSQPDPNIVPHYNTSVLV-FAFSAVIELVAEPFWVV 147 purple sea urchin
EFX76726      73 -----KTRDHNWPQVINLLWLTVPSVIICSLTFCy--IWL--HLLELPADKYVADYKFAVYM-FGASCTIESFVEPVYIF 142 common water flea
EFN65476      72 -----NTAEHNWAQVVNLLWLTVPICLVMSFLFGy--IWL--FLLSTAEALPPY-YTFAVWA-VGLSCIIELSSLIVQLV 140 Florida carpent...
Q9Y123        76 -----QGDRCSWAQLINQMWLTVPICAVLCAPCLy--IWL--NWLSAVDAIYASQYEFACYA-VAFSCVLELMAESAVFV 145 fruit fly
Q6C6S3       179 ggvvqDTVSGTSQAVINMGYISVLLGVFFSSVAA-----------ASHSLFSVAYASWAVQL-VCIAAMVDLASEPYYVL 246 Yarrowia lipoly...
EMD39779      80 ---tsEKKSDDEALVSNISLLPILLGVPTAILAT---LLY--LKTASSTTTSQPHFRLAVVI-YALAALFELLSEPLYVR 150 Gelatoporia sub...
CCD23329     166 NQFMLNYSSR--------SRIESLAITMGCITNFIIVVSFEKNWwnpilksmihhnnelmdqeefmevsREGIAILAFAV 237 Naumovozyma dai...
ERN16275     148 AQNMLLFGLR--------LKVETAATTLRCMTTYFLIINQTNEGk-----------------------------ELVFAL 190 Amborella trich...
NP_196380    237 SQTLLKLQLR--------LIVETVATLARCVTLYSLLVMQTNMEk-----------------------------VIIFAL 279 thale cress
Q23444       129 S---LRLESKcgslaqhfAIGQGMLICVKRIFVLAGLFMFPGMYh-----------------------------LELFAY 176 Caenorhabditis ...
XP_011674796 148 GQAMLFVRLK--------VVIEGIAIGIRCSLTVFFLIINPQIG------------------------------ITAFCI 189 purple sea urchin
EFX76726     143 SQAFQYVRWR--------IFVDCVMMFIRVGTLVVSVLYFPAYT------------------------------IKTMAC 184 common water flea
EFN65476     141 ANAFLFVRLK--------IILDTIMIAIRTMTFVPLILYYPENA------------------------------LLAFGI 182 Florida carpent...
Q9Y123       146 AQVFCFVKLK--------ILLNTLHILVRSAIFLWIVTGDRSAA------------------------------INAFAI 187 fruit fly
Q6C6S3       247 AMQQLRFRSR--------AAAEAVAILVRCVVTFSFTLLAKDTd------------------------gGLNGGVLAFAF 294 Yarrowia lipoly...
EMD39779     151 AQNELRVDVR--------VRAEGAAVVMKTVVAFAALVVLDAEWa-----------------------------LVAFAL 193 Gelatoporia sub...
CCD23329     238 GKLVHSLILLLCYYWDYLMNFH-ETKTFSLKLTKIYne-----------nkSTMTKNYYY-------------------- 285 Naumovozyma dai...
ERN16275     191 SQVAYGASLFVGYWGYFLSLYIfQNQNfitpgflfp---------------------------------------lrvwe 231 Amborella trich...
NP_196380    280 SQVAYGGSLFIGYWAYFLICGVyRSSNlfpfrp---------------------------------------------gn 314 thale cress
Q23444       177 AQYIGAIAYLLFNFVAFYIYIRnKS----------------------------------Ipeleqfstfs----dlfpkf 218 Caenorhabditis ...
XP_011674796 190 AQIVYSYVCVFLYFLYFSNYATfLAKKDDsfpikaardf----------------------------------fprhlpd 235 purple sea urchin
EFX76726     185 GQFVVSTVLVVLYWIYFHQEFQkKAKVVKHKDLHPDdpllalpfdslr-----------------------dflprkiqd 241 common water flea
EFN65476     183 AQLVAAIFYTTSHYVYFHYHIAkLNKCTQKRRMs-----------------LRGSSDEFVvrefpfhtvkdflpgqlenn 245 Florida carpent...
Q9Y123       188 AQLSSAVTIVLGQYGFFYFYLKgFKDFVTQQAKKKPvapka------wqvsLYEHMDdfpfkqlsdfl----pgvmfnpn 257 fruit fly
Q6C6S3       295 GQLAYSLISSAVYIYTVRQDNR--DRQFSFRPQKIQpfesqmemsdnnrdvITHNASPYY-------------------- 352 Yarrowia lipoly...
EMD39779     194 GQAAYGLTMLVEFARAY-------RGKSVFWMKKVEr-------------sVHDNTKTMY-------------------- 233 Gelatoporia sub...
CCD23329     286 ---FQNDILEHFKKVYFQLCFKHLLTEGDKLIINSLC--TVEEQGIYSLLSNYGSLVTRLLFAPIEESLRLFLARLL--- 357 Naumovozyma dai...
ERN16275     232 ektYDRQLLLMSFLFTFQSFQKLVLQEGEKLIIVLFD--TPYNQGVYGLVDKLGSLVVRSVLQPFEESSFTIFAKFA--- 306 Amborella trich...
NP_196380    315 fmdFDNDLSKMCKLFTFQSFRKLILQEGEKLVLVWLD--TPYNQAVYGIVDKLGSLVVRMVFLPFEESSYTIFARFA--- 389 thale cress
Q23444       219 segIDRDSIHAVFTMFSHSILKQLLTDGSAYVMTFTEllSLKDQAVYDAVERVGSIIVRTILSPIDENCNAYFSNTIrke 298 Caenorhabditis ...
XP_011674796 236 kpwTSPELARLTWSFFKQGFLKQLLTEGERYVMTLLNvlSFSGQGIYDAVNNLGALAARFIFLPIEESGYIFFSQTLkrg 315 purple sea urchin
EFX76726     242 qtfIGGDLAFLTWGFFKQGILKQVLTEGERYVMTVFAvlSFAEQGVYDVVNNLGSMAARFIFLPIEESSYFYFAQMLnrq 321 common water flea
EFN65476     246 dsyLDKKLTILTWSFFRQGILKQILTEGERLIMTIMPvlTFTEQGTYEIVNNLGSLAARFIFRPIEESGYFYFTQTVkrd 325 Florida carpent...
Q9Y123       258 gkhFNRELQTLTLSFVKQGVLKQILTEGEKYVMSVSPvlSFGEQATYDVVNNLGSMAARFIFRPIEDSSYFYFTQTLsrd 337 fruit fly
Q6C6S3       353 ---LDKPTVRLAGSIWIQTVFKHCLTEGDRILVSYFL--PLYDQGVYAIVLNYGSLVARIVFFPIEEGLRTFFSNLLg-- 425 Yarrowia lipoly...
EMD39779     234 ---FDPALLRLSTEMTGQSVVKHFLTEGDKFLVSRLS--PLADQGGYAIASNYGSLVARIIFQPIEETSRVFFSKTLss- 307 Gelatoporia sub...
CCD23329     358 ---SNRTAKNLKLSMQVLINLTKFYFYLSLLIVIFGPVNSSFLLQFLIGSK---WSTT----SVLD-TIRVYCFYIPFLS 426 Naumovozyma dai...
ERN16275     307 ---SGRITTKSFGLENIFLLALKLVILLGLVVLTFGPSYSYVLIRILYGRK---WSDG----EASE-ALACYCLYVLVMA 375 Amborella trich...
NP_196380    390 ---SGDYQERNKKLGIYLTVALKLVILIGLIFMAFGPSYSYSLIRLLYGEK---WSDG----EASL-ALQFYCLYIIVLA 458 thale cress
Q23444       299 ssvFNKNTDNHDDLVDTLSKVLHVVGVIGFVACTFGIPYSPVVISLYGGKL---LSEN----GGAL-LLSLYSGYILVTA 370 Caenorhabditis ...
XP_011674796 316 hsfKQQDKDSIQLASKVLQALLKFVVLVGSIILIFGFAYSYLLLDLYAGPV---LSSP----PGPK-LLRWFCVYVLLLA 387 purple sea urchin
EFX76726     322 ipiENQPRQEIDQVARVLFKLLRALILLGGIVVVFGFSYSHLLLHLYGGAT---LTEG----SGPL-LMRTHCLAVCLMA 393 common water flea
EFN65476     326 kliSDQNPGEIQESVNVLTHLCSTVTSIGLIVLVFGQSYSSTLLWLYGGSK---LTL-----PLPVlLLRAHCLAILLLG 397 Florida carpent...
Q9Y123       338 iklAKQPQERVRQASSVLNNLLLGVSSIGLIAFTFGQSYSYPVLLLYGGPD---FVAG----GLPQsLLQWHCLAIYLLA 410 fruit fly
Q6C6S3       426 ---EKPSETALKLSRQVLCSVVRIYTYVALFAAGFGPTTLPFIFGTLLGARggqWSEGapsrSAPA-VMGAFALYIPFMA 501 Yarrowia lipoly...
EMD39779     308 --aPSNSRPALETASTILHALLLLFTHLLLLLVTFGPPYLALGASLLLPPR---YLHT----SAPA-ILRAYIYYIPAMA 377 Gelatoporia sub...
CCD23329     427 LNGIFEAFFQSTATGDQILKHSYFMMVFSGVFLLNCWILIEFLNLSINGLIYGNIFNMILRITYCSWFIINFYKKLYNSe 506 Naumovozyma dai...
ERN16275     376 VNGTTEALLHAVGTKQQLVWSNASLVLFSGIYIVLNILLVQS--AGAIGLIVANSLNMMLRIIYSTLFIKRFFRDSPS-- 451 Amborella trich...
NP_196380    459 MNGTSEAFLHAVGTKNELERSNDMLLIFSLIYVALNILLIRS--AGAIGLIMANSLNMIFRIIYSGRFIQRYFQGTSS-- 534 thale cress
Q23444       371 INGITEGFAMASMDNRQIFTHGKFLFVTSIIHLIINYVLCVY--MNSAGFIVANIINMSVRIIYNWRTIRE-YLGDKC-- 445 Caenorhabditis ...
XP_011674796 388 INGTTECFVFAAMSQQEVDRYNTKMLGFSIVFLTSSWYLTKT--IGSVGFILANCLNMLARIIHSIYFITKFYSGSSI-- 463 purple sea urchin
EFX76726     394 INGVTEAYVFAAMSPQQLDKYNGLMVILSCMFLFLSWMLSRS--IGSVGFILANCVNMILRVIHSLWFIKRQYKHFEF-- 469 common water flea
EFN65476     398 INGVTECYTNATADSATINKSNIIMIYESIAFLGASYLFATW--FGPVGFIFGNCVNMSLRIIYSAMFINKRHRDTIY-- 473 Florida carpent...
Q9Y123       411 VNGISEGYMFATNTSRDIDKYNYLMAIFSVSFLVLSYILTGI--FGPVGFIFANCINMLSRILYSTYYIRHQYRPLSL-- 486 fruit fly
Q6C6S3       502 LNGALESFVQSVATPADLRRQAVALGVFSVVFATVGGLLMKTMDLGARGLVFANIVNMTLRIGWSVVFIYHYYVSHKAEn 581 Yarrowia lipoly...
EMD39779     378 FNGVLEAFLASVAAPADLRAQSRWMAAFSVAFVVAAVGMTQVLGMGDRGLVWANVANLLLRAGYAWRFVLGYFGTRGAGe 457 Gelatoporia sub...
CCD23329     507 enistssmkdstlvkdkgsifvnfRNFRVVIIVGLCIST-FNWIMI-GHV-------------KNFHQLFINIVLALILF 571 Naumovozyma dai...
ERN16275     452 ------------------------FGFRHCLPSAGVFAV-LFISGVaTHIsrrklfdrenffsTMIMHVTVGLTCFAVSV 506 Amborella trich...
NP_196380    535 ------------------------FSFRKCFPLGWQI---LILSSIiTLIsektildrknfweTFPLHFGIGVICFCLSA 587 thale cress
Q23444       446 ------------------------PSFTEVLPTGQTSIF-LGVSLLaTSFtyllfa-ttpglsYTLAHIAIGAVCLILTA 499 Caenorhabditis ...
XP_011674796 464 ------------------------RPLRGLFPSVYVLIT-LAFSWLiTTMselkyr--qktwsDRLTHIGIGGACLLGVL 516 purple sea urchin
EFX76726     470 ------------------------KPLGGLIPSVLECAA-MILAFVvTATsswf-----iypdSAILHVAIGAISGIVVV 519 common water flea
EFN65476     474 ------------------------RPLRGLVPKPLFSAS-LLIAAFiTNLshay-----ffpaEKILHLFVGIMMFMIVL 523 Florida carpent...
Q9Y123       487 ------------------------DPLLGLWPGKLFGCT-LFLAGIvCYWyq---------ssDLATHLGVGVLAGLACL 532 fruit fly
Q6C6S3       582 ------------------------VNPTHLLPGKLVIAT-GVTTILaSLFgvg--------rvSSFRDVGINIGLALALA 628 Yarrowia lipoly...
EMD39779     458 -----------------------mASWKKAAPPTPVLVAfAVSAAIaRWSeavyqn-vplrlgAQIGHVGVGILCLVGCL 513 Gelatoporia sub...
CCD23329     572 ITILLQERTILKGLL 586 Naumovozyma dairenensis CBS 421
ERN16275     507 IVIYRCERDFIQRIR 521 Amborella trichopoda
NP_196380    588 IVIYRRERVFIKRIK 602 thale cress
Q23444       500 QDTAQHDSVFTVIVD 514 Caenorhabditis elegans
XP_011674796 517 IVIVFTEAQLVSFIK 531 purple sea urchin
EFX76726     520 VAILYDEPELMRSIV 534 common water flea
EFN65476     524 MSWMYENYELLRLAA 538 Florida carpenter ant
Q9Y123       533 LSWALAHRDLVRLAW 547 fruit fly
Q6C6S3       629 AAIAVEERQALVQLV 643 Yarrowia lipolytica CLIB122
EMD39779     514 ATCIVFERATFRHMY 528 Gelatoporia subvermispora B
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap