Conserved Protein Domain Family
SchA_CurD

?
pfam04486: SchA_CurD 
SchA/CurD like domain
Members of this family have only been identified in species of the Streptomyces genus. Two family members are known to be part of gene clusters involved in the synthesis of polyketide-based spore pigments, homologous to clusters involved in the synthesis of polyketide antibiotics. The function of this protein is unknown, but it has been speculated to contain a NAD(P) binding site. Many of these proteins contain two copies of this presumed domain.
Statistics
?
PSSM-Id: 398272
Aligned: 12 rows
Threshold Bit Score: 170.656
Threshold Setting Gi: 502883561
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_015787640         1 MPYAAISYRVKEGYEDDLARLFSNIGRVSSPVLHDESGKEVGMLLGTAVFIEGPMIVRFIHYSgGTLEDVARHMSHQPAV 80  Saccharom...
WP_013227245         1 MPYAAITYDIKPGFEDEIAGIFANFKRADSPIMRDESGTEVGRLLGTAVFIRDAQLVRFIHYE-GDFAQIGRHMARQEGV 79  Amycolato...
WP_015621180         1 mSIAAISYDIKAGHEEQIAEIFGNFRRTGSPVIRDESGAEVGRIVSTALFIKGATMVRFIEYE-GRLSDVARFMAAQPGV 79  Actinopla...
jgi:Sros_4182        1 MPFVAITYDIKGGNEDRVAEVFSNFQRPRSAVVPGADGGQAGRILATAVFIRDSLLVRFIEFE-GDLDAVARHMAAQPGV 79  Streptosp...
WP_013118537         1 MQRYALTFRVKPGSQEKVKQLLADYDPPQWRT------EDGALLLGTSIFMKDDVVVRFVEVE-GNIGRIMAHLSKQPSI 73  Cellulomo...
BAJ32997           148 VVRHALSFTVKPGSEARAAELLAGYRSPQARV------DDTTRLLRTSLFIRGNRIVRCVEVA-GDLVAALRHVARQPEV 220 Kitasatos...
WP_012785304       143 iIRHALTFNVKPGSEQTVADILAGYTSPASQV------DETTRLVRTSLFMRGNEVVRSVEVM-GDLVAALRHVAAQPEV 215 Catenulis...
WP_010984268       136 VVRHALTFTVKPGSEPMVAKILAGYSSPQAQV------DENTRLRRTSLFMHGNRVVRAIEVE-GDLMAALRHVSRQPEV 208 Streptomyces
P23158             160 VVRHALTFTVRPGTEAETARLLSEYVSPDAHV------DGSTRLLRTSLFMSGNRIVRAVEVR-GDLQTALRHVARQPGV 232 Streptomy...
CeBiTec:B446_17650 133 VIRHALTFTVKPGTEEKVAKILSDYASPKAEV------DATTRLCRTSLFMHGNRVVRAIEVR-GDLLAALRHVARQPEV 205 Streptomy...
SIPI:L083_3129       1 MPYAAISYRIKPGHDDEIAELFAGFRRVSSPVLHDEGGQANGRLLGTAVFIKDDVLVRVIHYE-GDFAAVGRHMAAQQGV 79  Actinopla...
jgi:Sros_4142        1 MPFAAITYRVKLGFEDEIAEIFAGFQRVNTPVMRDEEGEQAGRLLGTAVFIKDDVMVRVIHYE-GDFRAVAAHMAGQRGV 79  Streptosp...
WP_015787640        81 HNFEEALQPYLAEERDTTTPEAFREFFTKSTMRCLTQAS 119 Saccharomonospora viridis
WP_013227245        80 HLVEEQLKPYLASERNTETPEGFRQHFAKSLMRCISQIS 118 Amycolatopsis mediterranei
WP_015621180        80 REVEQRLKPYLSRPRDTGTVEGFIATFERSTMRCLSLLs 118 Actinoplanes sp. N902-109
jgi:Sros_4182       80 QEVERKLRPYLNSPRDTTTVEGFVRTFKSSMLRCVTQLS 118 Streptosporangium roseum DSM 43021
WP_013118537        74 QQLERDLDEHLLEPRDMSTPQSARAFFQTAMMEHVTTrv 112 Cellulomonas flavigena
BAJ32997           221 RAVEEAINPYLEEDRDLDDPLSARDFFQRAALPAVHHHA 259 Kitasatospora setae KM-6054
WP_012785304       216 RAVEEAINPYLEQARDLNDPLAARDFFMRAALPAVHHHA 254 Catenulispora acidiphila
WP_010984268       209 MAVEEAINPYLEQDRDLSDPGSARVFFTRAALPAVHHVS 247 Streptomyces
P23158             233 RAVEEALNPYLEQDRDLGDPQSARRFFTRAAMPAVHHAT 271 Streptomyces coelicolor A3(2)
CeBiTec:B446_17650 206 RAVEAAINPYLEQDRDLDDQESARMFFTRAALPAVHHVS 244 Streptomyces collinus Tu 365
SIPI:L083_3129      80 HDLEGKLAPYLAVPRDTRTPEAFQAYFRDAVMRPVSQLS 118 Actinoplanes sp. N902-109
jgi:Sros_4142       80 HLIEEKLAPYLAEQRDTSTPGAFGAYFRDAVMRCVSQLS 118 Streptosporangium roseum DSM 43021
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap