3HRL


Conserved Protein Domain Family
DUF559

?
pfam04480: DUF559 
Click on image for an interactive view with Cn3D
Protein of unknown function (DUF559)
Statistics
?
PSSM-Id: 398268
Aligned: 8 rows
Threshold Bit Score: 123.636
Threshold Setting Gi: 81534675
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3HRL_A   5 SEAEAKLWQHLRAGRLNGYKFRRQQPXGNYIVDFXCVTPKLIVEADGGQHAe--qAVYDHARTVYLNSLGFTVLRFWNHE 82  Neisseria gonorrhoeae...
Q9A4J3  70 PAMERVLWRLLRDRRLDGLKFRRQLPIGRYVVDFACLRHRLIVEADGPYHD----EARDAQRDAWLAGQGFRVLRFKNDE 145 Caulobacter vibrioides
Q9AB13  15 TLAEKTLWTLVRAHRLGGFKFRRQTPIGGYFADFVCEQARLIVELDGAAHEg--rEDYDARRTEALERFGYAVLRFRNER 92  Caulobacter vibrioides
Q9A4L6  15 TFAEKALWTLVRNRRLGGFKFQRQAVIDRYIVDFVCESAKVIVELDGAAHDg--rEEHDANRARILEPCGYLVLRFRNEQ 92  Caulobacter vibrioides
P45736  17 TLQERKLWRYLRSRRFSDFKFRRQHPVGSYILDFACCSARVVVELDGGQHDl--aVAYDSRRTSWLESQGWTVLRFWNNE 94  Escherichia coli K-12
P44075  20 TDTERKLWQRINRDQLLGFRFNRQKPLLSYIVDFYCAKTKLIIELDGSQHYkpdyQEKDALRDAELNSLGFTVMRFSNDE 99  Haemophilus influenza...
P44116  40 TDAEYALWYHLRNKLFCGIRFNRQVIIGHYIVDFCSRKLKLVIELDGIQHVe--qEQYDLERTKFLTAQGYKVIRFWNDE 117 Haemophilus influenza...
Q9RXT5  72 TVEEKTLWLALRNRFLN-VKFRRQWPMGGYVVDFVCFEAKLIVELDGSQHAeeaaRDYDAVRTEFLEAGGFTVLRFWNNE 150 Deinococcus radiodurans
3HRL_A  83 IlQQTNDVLAEILRVLQ 99  Neisseria gonorrhoeae FA 1090
Q9A4J3 146 L-NNPDRVLGLILEACA 161 Caulobacter vibrioides
Q9AB13  93 VlADPGGTADDILAALR 109 Caulobacter vibrioides
Q9A4L6  93 VlVDPGGTTDEILTVLR 109 Caulobacter vibrioides
P45736  95 IdCNEETVLENILQELN 111 Escherichia coli K-12
P44075 100 VmREIEAVVEQIYLFLE 116 Haemophilus influenzae Rd KW20
P44116 118 VlKNIDNVLEAIYVEIE 134 Haemophilus influenzae Rd KW20
Q9RXT5 151 VrKNLEGVLLEIQKRLP 167 Deinococcus radiodurans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap