Conserved Protein Domain Family
DUF555

?
pfam04475: DUF555 
Protein of unknown function (DUF555)
Family of uncharacterized, hypothetical archaeal proteins.
Statistics
?
PSSM-Id: 398264
Aligned: 21 rows
Threshold Bit Score: 131.65
Threshold Setting Gi: 121684697
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8TXC6            8 DYHVVLEAAWIVYNVDDEDDAINIAIAEAGKRLNRHgLDYVDIDVGFYECPEcGNEIEGVWIVAGTALVRLILSMRVFNA 87  Methanopyrus...
jgi:Halar_0743    2 DCRVVLEAAVPVYDVATPEAAVGAAISKLAGLLNPE-MDDVDIEPRDQRSPR-GAEIPPATVAAGDGLVALELGMTVYAV 79  halophilic a...
WP_020446858      2 DCRVVVEAAVPVYDVETPDEAVRIAISKTGEMLNPD-LNYVEIEMGERSCPHcGEHLETAFIAADEGLVALELEMTVFNV 80  Salinarchaeu...
A2SRZ6            3 DYRVTLEAGWTVKDVESVQDAIGIAVSEAGKRLHPS-AKFVDVDVMNMPCPYcGKEINTALVIARTGLVGLLLSMKVFKA 81  Methanocorpu...
WP_004038658      3 DYNVSLESAWVIKDVKSLDDAIGIAISEAGKRLNPS-AKFVEIESGFIQCPYcENDLNCALVVANTALVGLSLDMKVFNA 81  Methanofolli...
WP_015286378      3 DYLVTMEAAWLVRDVKTLDDAIGIAISEAGKRLNPA-AKFVEVEEGFLTCPYcEETLSSAIVVADTALVGLVLEMKVFRA 81  Methanoregul...
Q2FQN9            3 DYLVVLESAWTIRDADSVDDAISIAISEAGKRLNPT-AKFVEVEAGILSCPYcEEELPCTLIVARTALVGVKMEMKVYKA 81  Methanospiri...
jgi:Mpet_2013     3 DYLVTLDAAWILKDVKSLDDAIGIAISEAGKRLNPS-AKFVEIEIGQLACPYcEQEMSSALIVGTTALVGLALEMKVYKA 81  Methanolacin...
bsuwp:MCON_0549   3 NFNVLLEGAWLVRDVKTEDDAIGVAISEAGKRLNQRkMDFVEVEVGQWDCPEcNEPLDGVFLVASMALVALLFEIKIFNA 82  Methanothrix...
A0B7N9            3 NFLVALEGAWIVRDVKSADDAIGVAISEAGKRLNQSsMEYVEVEVGHSYCPScEEPLEGVLLVAGTALVGLVFEIKIFNA 82  Methanothrix...
Q8TXC6           88 ESEEHAIRIAKYEIGQALEDVP 109 Methanopyrus kandleri AV19
jgi:Halar_0743   80 ENEEHAVRIARSEIGQRLEGIP 101 halophilic archaeon DL31
WP_020446858     81 EREEHASRIARKEIGQCLENIP 102 Salinarchaeum sp. Harcht-Bsk1
A2SRZ6           82 ENPEHAVHIAKSVIGRALRDVs 103 Methanocorpusculum labreanum Z
WP_004038658     82 ESGEHASRIAKSVIGRALGNVP 103 Methanofollis liminatans
WP_015286378     82 ESKEHAERIAKSTIGKALRDVP 103 Methanoregula formicica
Q2FQN9           82 DSEEHARRIALSTIGKALRDIP 103 Methanospirillum hungatei JF-1
jgi:Mpet_2013    82 ESEEHAKRIAKSVVGKALRDIP 103 Methanolacinia petrolearia DSM 11571
bsuwp:MCON_0549  83 ESEEHAGRIAKSTVGKALGTIP 104 Methanothrix soehngenii GP6
A0B7N9           83 ESEEHAGRIAKAMIGKALGSVP 104 Methanothrix thermoacetophila PT
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap