3L7K


Conserved Protein Domain Family
Glyphos_transf

?
pfam04464: Glyphos_transf 
Click on image for an interactive view with Cn3D
CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase
Wall-associated teichoic acids are a heterogeneous class of phosphate-rich polymers that are covalently linked to the cell wall peptidoglycan of gram-positive bacteria. They consist of a main chain of phosphodiester-linked polyols and/or sugar moieties attached to peptidoglycan via a linkage unit. CDP-glycerol:poly(glycerophosphate) glycerophosphotransferase is responsible for the polymerization of the main chain of the teichoic acid by sequential transfer of glycerol-phosphate units from CDP-glycerol to the linkage unit lipid.
Statistics
?
PSSM-Id: 398259
Aligned: 16 rows
Threshold Bit Score: 320.448
Threshold Setting Gi: 1169895
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3L7K_B 348 Dn-VKPKTIVFESFGGKNYSDSPKYIYEYMQ--KYYPNYRYIWSFknp--------dkNVVPGSAEKVKRNSAEYYQAYS 416 Staphylococcus epider...
Q9CH14  23 R--VKKNRITFISLEHDNLSKDFKLIYDRLKkkDQYELRTVLFKF-------------ESSLWGNIKYGYACIRQLFLIE 87  Lactococcus lactis su...
Q2G1B8 207 L--KKGNTVLFTSDSRPTMSGNFEYIYNEMLrqNLDKKYDIHTVFk------------ANITDRRGII--DKFRLPYLLG 270 Staphylococcus aureus...
P27621  27 P---ESKVTLLISF-----EANAKAILEEYEqgQYSYKLNILYTQqasaiaesfpnvdAYLLQEKNPIHL--IKAVYLMF 96  Bacillus subtilis sub...
O26465  49 P--KDDGLAVFDSV--PDFSGNSQALFEFMR---DMGEPEAVWIVe-----------ePLDIEGVRQERRHSLRALLTIL 110 Methanothermobacter t...
O26461  32 P--KRDNQILFESI--PDFSDNPSQLYSYIK--SLGTDYRMIWVVd-----------sIRDDLDAPQYLRNTPSEFWQFL 94  Methanothermobacter t...
Q9CH15  27 FvkTDYKLVIFASFNGKAYSDNPRYLFEYLRdhEEFASYHFVWAFk-----------vKRSVNRAKVVKFNSFSYYYLLS 95  Lactococcus lactis su...
Q9CH20  17 Sc-INSDTILYESRDGSTISDSPLALFLSLAnnKDYTNFQHVWVVmdklsslnlinvpESLKSKILFVERNSKEYVDYML 95  Lactococcus lactis su...
P13485 378 P--VKRKTVIFESFNGKQYSCNPRAIYEYMR--ENHPEYKMYWSVnkq-------ysaPFDEKGIPYINRLSLKWLFAMA 446 Bacillus subtilis sub...
Q2G1C1  25 P---NKNLIYFESFHGKQYSDNPKALYEYLT---EHSDAQLIWGVkkg-------yehIFQQHNVPYVTKFSMKWFLAMP 91  Staphylococcus aureus...
3L7K_B 417 EASHWVSNARTPL--YLNKKENQTYIQTWNGT-PLKRLANDMkvvrmpgtttpkykrNFNR----ETSRWD---YLISPN 486 Staphylococcus epider...
Q9CH14  88 SSRLVIIDYNNFVvsKFPHRKNVKVLQLWHATgALIKFGNDV---------------ERDY----IVNHYD---YTIVNS 145 Lactococcus lactis su...
Q2G1B8 271 KADYIFVDDFHPLiyTVRFRRSQEVIQVWHAVgAFKTVGFSRtgkk-------ggpfIDSL----NHRSYT---KAYVSS 336 Staphylococcus aureus...
P27621  97 NSKVIITDNYFLLtsVLNKRKQTKCIQVWHANgSLKKFGLEDitnmqr---tktdikRFQK----VYSSYD---YLTVGS 166 Bacillus subtilis sub...
O26465 111 RAGSLVST---HGrmSEIRVRRQKYVNLWHGM-PLKAMGYAEtg-----------grEFKE----PVRFDDenyYLIATS 171 Methanothermobacter t...
O26461  95 RSRYIVSS---HGyhLMIRAGNQVYLNLWHGM-PLKAMGYTErep-----------------silLPGVCDenyYLIATS 153 Methanothermobacter t...
Q9CH15  96 KAKYWVFNSKMAP--YYHKKGEQVYLQTWHGT-PLKRLGHDIldngityyrsrlsyqQMLRsydeDSRHWD---YLISPN 169 Lactococcus lactis su...
Q9CH20  96 TAKYLITNSTFQS--WFSKKKEQVYINTWHGT-PLKAMGFDIenql-------gntqNVLR----NLLMTD---YFLSPN 158 Lactococcus lactis su...
P13485 447 RAEYWVVNSRLPL--WIPKPSHTTYLQTWHGT-PLKRLAMDMeevhmpgtntkkykrNFIK----EASNWD---YLISPN 516 Bacillus subtilis sub...
Q2G1C1  92 RAKAWMINTRTPD--WLYKSPRTTYLQTWHGT-PLKKIGLDIsnvkmlgtntqnyqdGFKK----ESQRWD---YLVSPN 161 Staphylococcus aureus...
3L7K_B 487 RYSTEIFR----SAFWMDEERILEIGYPRNDVLVNRANDQeyLDEIRTHLNLPSDKK--VIMYAPTWRDDEFVskgk--- 557 Staphylococcus epider...
Q9CH14 146 DFLKPIFA----RAFNVIEDQVFVTGIPNNDKIFDQNFVDltCQRLVGKYPLLKGKK--IITYAPTFRGRISThf----- 214 Lactococcus lactis su...
Q2G1B8 337 ETDIPFYA----EAFGIKEKNVVPTGVPRTDVLFDEAYATqiKQEMEDELPIIKGKK--VILFAPTFRGSGHGtah---- 406 Staphylococcus aureus...
P27621 167 EEMANIFK----KSFGIKDNQLLKIGVPLTDPYYRENKKK-----ISDTLNIQRKK---IILYAPTFRDYNMQs------ 228 Bacillus subtilis sub...
O26465 172 TIMRNAMA----ACFNQDARRIHITGQPRNDKLFRS------DGRIPEITGIDTGSYskVVLFAPTFRASDYIsdgrlis 241 Methanothermobacter t...
O26461 154 TIMRNALA----ACFNQDARRIHITGQPRNDKLLTE--------------GRTMDDSrtIILYTPTYRDTGRDesi---- 211 Methanothermobacter t...
Q9CH15 170 PFSSQAFT----SAFNLDRGKLLEVGYPRVDFLVNADSNK--CMELKRRYGLPLDKK--VVLYAPTWRDDSFGirg---- 237 Lactococcus lactis su...
Q9CH20 159 PHTTKIFAgsgyKMRGIYKGEIIESGYPRIDLTKETSSDD--AKNLLKELGIELDSNlpVVVYMPTWRGNDTQnpsd--- 233 Lactococcus lactis su...
P13485 517 GYSTEIFT----RAFQFNK-TMIESGYPRNDFLHNDNNEEt-ISLIKSRLNIPRDKK--VILYAPTWRDDQFYakgr--- 585 Bacillus subtilis sub...
Q2G1C1 162 PYSTSIFQ----NAFHVSRDKILETGYPRNDKLSHKRNDTeyINGIKTRLNIPLDKK--VIMYAPTWRDDEAIregs--- 232 Staphylococcus aureus...
3L7K_B 558 -ylfELKIDLDNLY-KELGDDYVILLRMHYLISNALd-lSGYENFAIDvsNYNd------VSELFLISDCLITDYSSVMF 628 Staphylococcus epider...
Q9CH14 215 ---kEALIDLEKIH-QAIGNDYIVIYKSHPLIQHSN---YEKNEHVLYiqDEL-------ISSLFCVTDILVTDYSAIAI 280 Lactococcus lactis su...
Q2G1B8 407 --ypFFKIDFERLArYCEKNNAVVLFKMHPFVKNRLniaDKHKQYFVDvsDFRe------VNDILFITDLLISDYSSLIY 478 Staphylococcus aureus...
P27621 229 ---iQLPFTEEQLI-HQLKEEYVLFVKLHPAIQNNId-iKYSSDYIKDvsNYA-------LFDLLMAADILITDYSSVPF 296 Bacillus subtilis sub...
O26465 242 hhlnLPDFDAEAFSgFLKEKNILFLVKFHPLEEEEArrfFSEMDNVVLigSDDlaerymdLYDVLPGVDVLVTDYSSVYF 321 Methanothermobacter t...
O26461 212 --fsMPDYSEEKFQdFLREHDAVFLMKLHPLDSGIR---QRSGGNIRAldPSEd------LYDILQGVDVLVTDYSSVYF 280 Methanothermobacter t...
Q9CH15 238 -yrfELAVDFYKWK-NQLGDDTVILFKPHYLISNVYqipNDLSNFVYLmaASAd------INDAYLMSDVLITDYSSVFF 309 Lactococcus lactis su...
Q9CH20 234 -siaQVIAELKYLR-KEFLGKYNIILKVHPYLYKKAknyKELSGVLID--DAMd------ANLVLAATDILITDFSSVFF 303 Lactococcus lactis su...
P13485 586 -ykfDLDLDLHQLR-QELGNEYIVILRMHYLVAENFd-lGPFEGFAYDfsAYEd------IRELYMVSDLLITDYSSVFF 656 Bacillus subtilis sub...
Q2G1C1 233 -yqfNVNFDIEALR-QALDDDYVILLRMHYLVVTRI---DEHDDFVKDvsDYEd------ISDLYLISDALVTDYSSVMF 301 Staphylococcus aureus...
3L7K_B 629 DYGILKRPQFFFAYDIDKYDKGlRGFYMNy-MEDLPGPIYTEPYGLAKELKNLDKVQQQYQEKIDAFYDRFCSVDNGKAS 707 Staphylococcus epider...
Q9CH14 281 DWMVFNKPIIAYSPDLMTYSHK-PGFTIDy-ENEFPGQVTKNEDELIKAIIAVNDETESDDLKRQLFTDKMYKFRDGKST 358 Lactococcus lactis su...
Q2G1B8 479 EYAVFKKPMIFYAFDLEDYITT-RDFYEPy-ESFVPGKIVQSFDALMDALDN----EDYEGEKVIPFLDKHFKYQDGRSS 552 Staphylococcus aureus...
P27621 297 EFSILNKPILFYTYDLKLYQQK-RGLVDNy-LSIIPGRACYDSESLINEIQT-----PFNYSKIKVFSDRWNKYSDGNSS 369 Bacillus subtilis sub...
O26465 322 DFLLLDRPVIFAVPDLEEYRRV-RGFVLEpfEFWAPGPRVETFSDFLEELERCLEDDDYYRRERRIVNSLVNQQQDGESS 400 Methanothermobacter t...
O26461 281 DFLLLDRPVIFAVPDLEEYRRV-RGFVLEpfEFWAPGPRVETFTDFLEELERCLEDDDYYRRERRIVNSLVNQHQDAGSS 359 Methanothermobacter t...
Q9CH15 310 DYANLNRPIYFYMYDFEQYEQElRGFYLNv-PDELPNDVIRTEKELLRRIKE----DIFDYDRLQVFNQVFNSWNDGKVS 384 Lactococcus lactis su...
Q9CH20 304 DYLVTDKPIIFYAWDQDIYSED-RGMYLD--MAELPAPILKTVIEIADYLSDIDQLSQDYLGKYLRAKEKYVPYDDGNVS 380 Lactococcus lactis su...
P13485 657 DFANLKRPMLFFVPDIETYRDKlRGFYFDf-EKEAPGPLVKTTEETIEAIKQISSPDYKLPVSFGPFYDKFCYLESGRSS 735 Bacillus subtilis sub...
Q2G1C1 302 DFGVLKRPQIFYAYDLDKYGDElRGFYMDy-KKELPGPIVENQTALIDALKQIDETANEYIEARTVFYQKFCSLEDGQAS 380 Staphylococcus aureus...
3L7K_B 708 QYIGDLIHK 716 Staphylococcus epidermidis RP62A
Q9CH14 359 DRVLDLIES 367 Lactococcus lactis subsp. lactis
Q2G1B8 553 ERLVRNLFg 561 Staphylococcus aureus subsp. aureus NCTC 8325
P27621 370 QNLLNFIEN 378 Bacillus subtilis subsp. subtilis str. 168
O26465 401 RRVYELVWG 409 Methanothermobacter thermautotrophicus str. Delta H
O26461 360 RRVYELVWG 368 Methanothermobacter thermautotrophicus str. Delta H
Q9CH15 385 SKVAKRIFY 393 Lactococcus lactis subsp. lactis
Q9CH20 381 ERIVDYIFK 389 Lactococcus lactis subsp. lactis
P13485 736 EKVVNTVFK 744 Bacillus subtilis subsp. subtilis str. 168
Q2G1C1 381 QRICQTIFK 389 Staphylococcus aureus subsp. aureus NCTC 8325
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap