1IN0,5B7W


Conserved Protein Domain Family
DUF520

?
pfam04461: DUF520 
Protein of unknown function (DUF520)
Family of uncharacterized proteins.
Statistics
?
PSSM-Id: 398257
Aligned: 270 rows
Threshold Bit Score: 181.439
Threshold Setting Gi: 123646871
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1IN0_A           2 PSFDIVSEITLHEVRNAVENANRVLSTRYDFRGVEAVIELNEKNETIKITTESDFQLEQLIEILIGSCIKRGIEHSSLDI 81 
Q3Z6X0           2 PSLDVVSVVDMQAMDNAVNNAKRDLGNRYDFKNAKYELVLNRKDKKIEIVAEDEFKLKAIIETLIQQCVRFKLDSKCLDV 81  Dehalococcoid...
jgi:Solca_1755   2 PSFDIVSKVDGQTLDNAINNAKKEIVNRYDFHDSKTEIDLDKKTNIVKIVTENDMRMKAIQDVIISRMVKQHLDANCLDF 81  Solitalea can...
WP_008511786     2 PSFDIVSKIDAQTLDNAINNAKKEILNRFDFHGSKSTIELDKKTNEVTVVTEDDMRLKAIEGSIISRMVKQSLDPNALDF 81  Mucilaginibac...
jgi:Pedsa_0145   2 PSFDIVSKIDSQTLDNSINNAKKEILNRYDFNDSKSTIDLDKKSNSLTIVTENDMRLKAIIDSIISRMMKQNLDPNSLDL 81  Pseudopedobac...
jgi:Phep_1634    2 PTFDIVSKVDAQTLDNAMNNAKKEILNRYDFSTSKSTIDHDKKTNVITIVTEDDMRLKAIQDAIISRMIKQNLDAKSLDF 81  Pedobacter he...
WP_012793783     2 PSFDIVSKVDTQTLDNAINTVKKEITNRYDFKDSHVTIELNKKELGLTIEVDSDMKLGQVIDVLISRTMRQGLDGNIFDL 81  Chitinophaga ...
jgi:Niako_2171   2 PSFDIVSKVDAQALDNAVNVTTKEITNRFDFKGSHVEIKLDKKEFKISIETEDDMKMRQLIDVLINRAHKQNIAPEAFDT 81  Niastella kor...
WP_008582733     2 PSFDFASKVDAQALDNAVNVVKKEITNRFDFKGSHVVIDLDKKAFKINVETEDDMKMKQLLDVLVSRAHKQGIAPEAFDL 81  Niabella soli
Q11SS5           2 PSFDIVSKVDPQTLDNALNVARKEITTRYDFRDSKTEIDLDKKASIIKVTTENSMRMNAIVDIVITRMAKQGIDAKALDM 81  Cytophaga hut...
1IN0_A          82 P-AESEHHGKLYSKEIKLKQGIETEMAKKITKLVKDSKIKVQTQIQGEQVRVTGKSRDDLQAVIQLVKSAELGQPFQFNN 160
Q3Z6X0          82 a-DAHTVSLGAAKTEIKIKDGLTKETASKITKFIKSTKLKLDSAIQGEQIRITGKQIDDLQEIMQLLNGQDFDVPLQYVN 160 Dehalococcoid...
jgi:Solca_1755  82 g-DEHYAAGNMIRKDIKVREGIDKELAKKIVKKIKDSGLKVQASIMDDQVRVQGKKIDDLQAVISLMRGEDLEQPLQYIN 160 Solitalea can...
WP_008511786    82 g-EEQYASGNMIRKSIKIKEGIEKEAAKKIVKKIKDSGLKVQASIMDDQVRVTAKKIDDLQAVISLCRTEDFGQPLQYIN 160 Mucilaginibac...
jgi:Pedsa_0145  82 EkPFYSVSGNLIRKDIAVKEGIDKETAKKIVKKIKDSGLKVQASIMDDQVRVQGKKIDDLQSVIQLCRSENFGQPLQFIN 161 Pseudopedobac...
jgi:Phep_1634   82 g-KEQYASGNMIRKEISVKEGIDKETAKKIVAKIKASGLKVQASMMDDQVRVQSKSIDDLQGVIALCKKEDFGQPLQFIN 160 Pedobacter he...
WP_012793783    82 s-KEHYQSGKVVKKDVPIRNGIKQEDAKKLVKLIKDSGAKVQAAIMDDIVRVTGKKIDDLQEVIQKTKEANLGIPLQYIN 160 Chitinophaga ...
jgi:Niako_2171  82 s-KESYQSGKLTKQEVSVRNGLKQEDAKKIVKLIKDSGLKVQASINDDLVRVTGKKIDDLQEVIALCRGAELGIPLQYEN 160 Niastella kor...
WP_008582733    82 s-KEGSQVGKAWKKEIEVRNGLKQEDAKKIVKLIKDAGLKVQAAINDEVVRVTGKKIDDLQSVIQASKTWELGLPLQVEN 160 Niabella soli
Q11SS5          82 s-KEEYASGPMVKRELPVKNGIDKESCKKIIKIIKDSGSKVTPAQMDDLIRVTGKKIDDLQEIIALLRSKDVGVALQFIN 160 Cytophaga hut...
1IN0_A         161 FR 162
Q3Z6X0         161 MK 162 Dehalococcoides mccartyi 195
jgi:Solca_1755 161 MR 162 Solitalea canadensis DSM 3403
WP_008511786   161 MR 162 Mucilaginibacter paludis
jgi:Pedsa_0145 162 MR 163 Pseudopedobacter saltans DSM 12145
jgi:Phep_1634  161 MR 162 Pedobacter heparinus DSM 2366
WP_012793783   161 MK 162 Chitinophaga pinensis
jgi:Niako_2171 161 MR 162 Niastella koreensis GR20-10
WP_008582733   161 MR 162 Niabella soli
Q11SS5         161 MK 162 Cytophaga hutchinsonii ATCC 33406
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap