Conserved Protein Domain Family
DUF512

?
pfam04459: DUF512 
Protein of unknown function (DUF512)
Family of uncharacterized prokaryotic proteins.
Statistics
?
PSSM-Id: 398256
Aligned: 189 rows
Threshold Bit Score: 176.439
Threshold Setting Gi: 506240759
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_012283043  223 VPVGLTSHREGLFPLRPFTADEAETVVHQVGAWQARALAERGESVFFAADEFYLLAGLPFPPAEVYEDFAQLENGVGLCR 302 Heliobacterium...
WP_044038766  219 VPIGVTKFREGLKQVETYDAEKANKELDLVKRLQDKYYKEIGEPFVRLSDEFYVVAGREIPETEFYGDFDQIEDGIGMIR 298 Clostridium bo...
WP_010077179  219 VPIGITKFREGLKELKVYDKESANSEIETVNKLQEQFYKEIGEPFIRLSDEFYILAEKTIPEKEFYSEFEQLEDGIGVIR 298 Clostridium ce...
tigr:CLC_2379 219 VPIGVTKFREGLYQFELFNKETANKELNMVEEYQNKFIKEIGKPFVRLSDEFYVIAEKEVPKEDFYDGFKQLEDGVGVIR 298 Clostridium bo...
WP_012101744  219 VPVGITKYRQGLFNLKQYNENSAREQLEIAEELQKKYIKEIGVPFVRFSDEFYIISNKEIPSAKFYENYKQLEDGVGMVR 298 Clostridium kl...
JLU:CLAU_3245 219 VPVGITKYRQNLFKLSRYDKNSASNQLKIAEELQCKYIEEIGVPFVRLSDEFYLVSETEIPNSNFYENYSQLEDGVGMVR 298 Clostridium au...
Q895X9        219 VPIGITKYREGLAKFSPYNEDGAREQLNTVKKLQEKYIKEISTPFVRLSDEFYVVGKENIPDKDFYQGFDQIEDGVGMIR 298 Clostridium te...
Q182W7        229 VPVGITKHRENLVELNIFNDKSASKTIEQIHQIQQKYLEKLGTRFAFLSDEFYILSNSELPGYEEYEGFLQFEDGVGMIR 308 Clostridioides...
WP_022072131  226 VPVGITKYRDNLAKLDIFNYESANETIDQVHALQEKYLKDLNTRFAFLSDEFYIIAKRPLLNYDEYEGFLQFEDGVGMIR 305 Clostridium sp...
WP_013362098  226 VPIGITKYRENLCKVEIFDKESANEVINQIDKIQNELLAKLGTRFAFLSDEFYVMANRNLPTKEAYEGYVQLENGVGLIS 305 Acetoanaerobiu...
WP_012283043  303 LFWEDWQEAAERsggavegnslsgeslpgrdsqggesssEGRTFIITGLSGQRFLDNLLTDARER-YDIKsktggIRLVG 381 Heliobacterium...
WP_044038766  299 TFRDAIDNDIHKlng----------------------kgIGKFTIPTGVSAYEEIKKGAEKIMDRnPNIK-----IEVIK 351 Clostridium bo...
WP_010077179  299 MFRDNIEDAVDSlkd----------------------niCGHFTIPTGVSAYKEIQEAALKIMKKsPKVR-----IDVVK 351 Clostridium ce...
tigr:CLC_2379 299 IFRNNIKDNVNKlst----------------------kaKGSFSLITGQSAYKEVIEASKMINNHsNDID-----IEVIK 351 Clostridium bo...
WP_012101744  299 IFRDNIKNGLKDlnl----------------------kaKGSFTLITGDLAYEEIKNAAKKIMKTnPHII-----IHVKK 351 Clostridium kl...
JLU:CLAU_3245 299 LFRDNISSHLKSlnk----------------------gaRGSFTFLTGELAYSEIKDAAEKIMENsPDII-----IDVKK 351 Clostridium au...
Q895X9        299 MLREEFKETLSNlnr----------------------nsKGSFTIVTGELAFKEFLTIKDEIKKVnDKIE-----IGVKK 351 Clostridium te...
Q182W7        309 KLKTEIEEYLNIlpek-------------------ilkrEKKVSIATGHSAYEFIQSMADAMMDKfKNLQ-----INVYE 364 Clostridioides...
WP_022072131  306 KQGTEIINYLEKlesd--------------------dsiKKTVSIATGSSAYEFISDMANKVMEKfKNIK-----INVYK 360 Clostridium sp...
WP_013362098  306 KLEHEIYEELEKtpk---------------------ypiNRHISIATGKSAFEFINSMAKLIMKEfEGLK-----IDVHM 359 Acetoanaerobiu...
WP_012283043  382 VPNKFFGPTVTVAGLLTARDVIDSLRSLgDpprkGDRVLLPSVMFR-------AEGDVTLDDETAEAIAEALgGVTVEVI 454 Heliobacterium...
WP_044038766  352 VINKFYGEKITVTGLIVGEDLISSLRNRd-----NGIILLCSSMFRkgyepgdESEKIMLDNTTLDDLKETL-DTNVVIV 425 Clostridium bo...
WP_010077179  352 IINNYFGETITVTGLITGTDLINQLKGKd-----VGTLIMSNVMFRkgyelgdYEDNIMLDNYTIGDIQNTL-GTTVKIT 425 Clostridium ce...
tigr:CLC_2379 352 IDNNFFGKTITVAGLITAKDIIEQTQEK-Nl---GKYVIIPDVMLRkgyeladISEQVFLDDVTLKELSNSL-KREILVC 426 Clostridium bo...
WP_012101744  352 IINNFFGNTITIAGLVTSKDILEQLKCE-Il---GNYLIIPECMLRkgyelseSNKRVFLDDVTLEELENSL-NRKILVC 426 Clostridium kl...
JLU:CLAU_3245 352 IINNFFGHTITVSGLITARDIMEQLKYK-Tl---GKNIVIPECMLRkgyelsnSDKRVFLDDITLDELEKAL-SRNILVC 426 Clostridium au...
Q895X9        352 IINNFFGETITVAGLITGSDIKEQLKKE-Ev---KDYILIPRNMLK-------ADEDIFLDDVTVKELEEFY-GKSIIIC 419 Clostridium te...
Q182W7        365 IKNKFFGETITVSGLLTAKDLKEQLEDK-El---GEALYITRSMLK-------ADEEIFLDNIELNQLEELM-RIKIIPC 432 Clostridioides...
WP_022072131  361 IKNDYFGHTITVSGLITATDIINQLKDK-El---GSALYITRSMLK-------SDEEVFLDDITLEQLKEKL-NIQVITC 428 Clostridium sp...
WP_013362098  360 ISNEFFGETITVAGLITASDIEKQLKDK-Dl---GEELIIPRSMMK-------ADEDIFLDNITLDELKQRL-KIEIVIS 427 Acetoanaerobiu...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap