1J27


Conserved Protein Domain Family
DUF503

?
pfam04456: DUF503 
Click on image for an interactive view with Cn3D
Protein of unknown function (DUF503)
Family of hypothetical bacterial proteins.
Statistics
?
PSSM-Id: 427961
Aligned: 197 rows
Threshold Bit Score: 63.9793
Threshold Setting Gi: 503319782
Created: 20-Apr-2021
Updated: 29-Sep-2021
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1J27_A               6 GLYTARLETP-ARSLKEKRALIKPALERLKARFPVSAARLYGLDAWGYEVVGFTLLGNDPAWVEETMRAAARFLAEAGGF 84  Thermus t...
WP_014872855        23 GVLTLHFQLYaCDDLKAKRKVFAPLKTIWGKEPDLAVAETDHQDILDCATWTVVALGSSSQQISQRLDQVEKAINERIDA 102 Marinobac...
Q2SN92               4 FVVRIEFQLQgCASLKEKRQRTSGVREKLGRQPHLAIIESGQADALQTGEWTIILLAPNRATADKHLSQLEQTLAQNLDA 83  Hahella c...
WP_015850885         4 GVLSLEFRLHgNRSLKGKRKVSLSLKQKLRNKFNLSVSEVEAMDSHERLILAAVTVANETRKVESTLSKALAMIEAMAPA 83  Maridesul...
WP_014320691         4 GVLHLEFRLHgNRSLKDKRKVSLSLKQKLRNKFNVSVAEVDALDVHDKLVLAVVTTANESGRVESTLSKALAMVEAISPA 83  Pseudodes...
jgi:Desaf_3746       4 GVLRLEFALHdNDSLKGKRSFTNSMKQKLRNKFNVSVSEIESQDSHTRLVLGVVTCGPDTQAVQGRLTKALNMVEAASTE 83  Desulfocu...
gigasnome:DGI_1558   4 GTLLLEFTLHgNDSLKGKRNVAQSLKRKLRNKFNVAVAEVDSMESHTRLVLACVTVSNDAAHAQGLLTKVQNMVEAATDE 83  Desulfovi...
jgi:DvMF_2512       10 GVLTVEFELHgNDSLKGKRRIASSLKTKVRNTFNVSIAEVRNQDSLTRLSLAVVSVSNSERHLQSRLDKCLAMMEAVCPE 89  Desulfovi...
jgi:Ddes_0058       13 AVLTVEFSLHgNDNLKAKRRVANSLKQKTRNKFNVAIAEAGTENSLSRLRLAVVSISNSEGHLRSRMDKCALMMEAVCPE 92  Desulfovi...
WP_015774583         4 GTLRLEFRLHgVFSLKEKRKSANSLKQKLRNTFNVSVAETEAQDSHQVLVLGVVTVSNDTAHVHSRLSKVLAMVEASTAD 83  Desulfomi...
1J27_A              85 QV 86  Thermus thermophilus HB8
WP_014872855       103 AI 104 Marinobacter sp. BSs20148
Q2SN92              84 RI 85  Hahella chejuensis KCTC 2396
WP_015850885        84 EL 85  Maridesulfovibrio salexigens
WP_014320691        84 EL 85  Pseudodesulfovibrio mercurii
jgi:Desaf_3746      84 DL 85  Desulfocurvibacter africanus subsp. africanus str. Walvis Bay
gigasnome:DGI_1558  84 EL 85  Desulfovibrio gigas DSM 1382 = ATCC 19364
jgi:DvMF_2512       90 EM 91  Desulfovibrio vulgaris str. 'Miyazaki F'
jgi:Ddes_0058       93 EM 94  Desulfovibrio desulfuricans ATCC 27774
WP_015774583        84 EL 85  Desulfomicrobium baculatum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap