4J3C,1NXZ,4E8B,4L69,1Z85,1VHK,2EGW


Conserved Protein Domain Family
Methyltrans_RNA

?
pfam04452: Methyltrans_RNA 
Click on image for an interactive view with Cn3D
RNA methyltransferase
RNA methyltransferases modify nucleotides during ribosomal RNA maturation in a site-specific manner. The Escherichia coli member is specific for U1498 methylation.
Statistics
?
PSSM-Id: 398249
Aligned: 86 rows
Threshold Bit Score: 147.746
Threshold Setting Gi: 3915343
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4J3C_B  49 EQFNYLINVLRLGEGSSLLVFN-GRDGEWRAEIAXPSRKQAvLVAV-EQTRPQPAPCD------LVYLFAPLKV-GRLDY 119 Sinorhizobium melilot...
Q6F1G3  20 NDVHHIKNVVKLKNDEIIECVY--EKEVYQTKIIDLTIENNvIVEI-INKVETTISNVk-----KVLIAGVLRE-QKWDY 90  Mesoplasma florum
Q9PQJ0  19 SDVHHIKNVMRMRLHDKVIVIN--KTKAFVAEIINLEPLHA--TII-KPYTLNCELATk-----IDLFQASIKP-NNFEW 87  Ureaplasma parvum
Q8EWP2  18 NDLKHF-KSLRINNEDIIDCID-QNNSLVKVKIKSLDPIKSeIIEI-KENKLSNKPYD------ITCFLGVIKK-QNFEL 87  Mycoplasma penetrans
2EGW_A  19 GEVKHF-RVRRIEKDEEFGVIH--EGKIYVCKVRREDKREIsCEIV-EELETKLPPKD------ITLYQSVTVDlKTMDT 88  Aquifex aeolicus
Q7VHH3  19 ENVNYLMKVRRVQLGETLALRNlNDDNLYTYELSEIDKKALtLRLQ-ASQNAPSNIKSh-----LHLLWAIIEP-KIIEK 91  Helicobacter hepaticus
O25138  19 ESYTHLYRSRRVKSASRLDLRNlKDGFLYTYEHAEITKKHAlLKLV-GARLLEVMASKk-----THLILSVIEI-KNIEK 91  Helicobacter pylori 2...
O51333  22 KIYHHLVNVRRLKKGDKLNILL-KDKELRASEIVKIGSNFIkFTTN-KIDKIEKNNFE------ISIFISSLKG-RKIDL 92  Borreliella burgdorfe...
Q73LI5  20 KDYNYLVSVRRIKEGQVLKISL-NGVKPASAEVFKINTEKKyIELRlLKEEFAFDAEPykpraeIILMQWLIKG-NHMDI 97  Treponema denticola
Q98Q27  19 EILNHI-KVARVQNKNFICIYE---QVFYLCKLEGKKALII------EKIDANHEFKNq-----VILAMSVINT-KRFEL 82  Mycoplasma pulmonis
4J3C_B 120 LVQKAVEXGAGVLQPVXTQHV------QGKIGSLERVRANVIEAAEQCGVLGIPAVEEp-rKLEDLLIDWPRD-R----- 186 Sinorhizobium melilot...
Q6F1G3  91 LLQKSTELGVDEIIPVIFKRNvvkideKKIDQKLQRWQAICDTAAKQAKRTTIPVVNNlitNLKDLKNNLCDL-N----- 164 Mesoplasma florum
Q9PQJ0  88 IVQKACELGVNSIYQTIFKRTy-----NHSLIKTNRILTIIKEACEQARRNHLVNYYAq-fSFNELLKYLRDYdLi---- 157 Ureaplasma parvum
Q8EWP2  88 AVVKLSELNIKKIIPVYFDYSq-----RNINLNYQRLDILIKESQKQCNRIAKLEIDEp-iTFNDMVNKLNDFnCn---- 157 Mycoplasma penetrans
2EGW_A  89 IVRQATELGVLTFVPIISERSfq--keEAILKKTEKWKRIVIEAMKQSRRPIPMEIKKp-vRLSDLIPESEEN------- 158 Aquifex aeolicus
Q7VHH3  92 TLPMLNELGVSRISFFYAAFSq-----GHFKLSLPRMEKILIQSCQQCGRSDLMELELy-kNFHRICEEYTDF------- 158 Helicobacter hepaticus
O25138  92 ILPFLNQLGVSKLSLFYADFSqr--neKIDIAKLERFQKILIHSCEQCGRSALMELEVf-sNTKEALKAYPKA------- 161 Helicobacter pylori 2...
O51333  93 VLRQVVEIGVSEINIINADRSvskidiNNASAKILRFSKIIDEALKQSGNKIVPKINFy-nNFFYLPYSFCTTrY----- 166 Borreliella burgdorfe...
Q73LI5  98 AVRQAAEAGCSLIVPVLGEFSvv---kKENINQTERRERIIREARQQSGSVVNTKILPa-qELKAALDSVLDYtAnrkta 173 Treponema denticola
Q98Q27  83 TIQKAAELGVSLFIPMLSQNVeqk-lgNDIDKKLQRWKTIALNACEQSFRNKVMEITYp-kSFNEVIEMEVKNk------ 154 Mycoplasma pulmonis
4J3C_B 187 RIVFCDEGNDSQNPLPiLEGIAEr------RLALLIGPEGGFSEAERDLLRSrDFVTAIPLGPR-ILRADTAAVAAXAVI 259 Sinorhizobium melilot...
Q6F1G3 165 LVAWEK---------EkNIELKTyltqdfnSISFIIGCEGGIEVSEIKILHE-IGFKNVSLGTN-ILRAETAPTYVLSSL 233 Mesoplasma florum
Q9PQJ0 158 LIAYENEKQNLLNNAFkEELTYQ-------KIALVIGPEGGFEQMEINLLKQfDNAICISLTKT-ILRSETASLYLLANL 229 Ureaplasma parvum
Q8EWP2 158 FIAYEHQDLSEWNKIKnNSNLN--------NISYIVGPEGGFSGKEINELKN--KCIFLKLTNT-ILKTETASIYLASIL 226 Mycoplasma penetrans
2EGW_A 159 IILDNFYEGVKPKDVNlEAK----------TYSVVVGPEGGFSKRESQILRE-KGFKSVLLEPY-TLRTETAVVSIVSIL 226 Aquifex aeolicus
Q7VHH3 159 YAFDFGGVDICNFTPCqNHSKIGke---khLVRIMVGAEGGFSTKERERFAK-----IITLNDTlILRSESASVFIASIA 230 Helicobacter hepaticus
O25138 162 SVLDFKGETLPASADF--------------EKGVIIGPEGGFSEPERGYFKE-REIYRIPLDM--VLKSESACVFVASIA 224 Helicobacter pylori 2...
O51333 167 YVAHPSGMILSKNESFdNFG----------KIGIIIGPEGCFSESEIVFFKE-KGFNFVRFNTP-ILRADTAIIYSLAYF 234 Borreliella burgdorfe...
Q73LI5 174 FIMLSEKKVGSFSFFDcLSAETE-------AIVLAIGCEGGIGSKEIEFLKE-HKFEEVHFNTN-VLRAETAAIYSIAAA 244 Treponema denticola
Q98Q27 155 YIAHEKAKDFLTKSSFeT------------NSLFLIGPEGGFSQKEIDLAQE-KSFELIWLGKR-ILRAETAAFFVLSRI 220 Mycoplasma pulmonis
4J3C_B 260 Q 260 Sinorhizobium meliloti 1021
Q6F1G3 234 I 234 Mesoplasma florum
Q9PQJ0 230 V 230 Ureaplasma parvum
Q8EWP2 227 I 227 Mycoplasma penetrans
2EGW_A 227 M 227 Aquifex aeolicus
Q7VHH3 231 K 231 Helicobacter hepaticus
O25138 225 Q 225 Helicobacter pylori 26695
O51333 235 K 235 Borreliella burgdorferi B31
Q73LI5 245 Q 245 Treponema denticola
Q98Q27 221 N 221 Mycoplasma pulmonis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap