2R6Z


Conserved Protein Domain Family
SAM_MT

?
pfam04445: SAM_MT 
Putative SAM-dependent methyltransferase
This is a family of putative SAM-dependent methyltransferases.
Statistics
?
PSSM-Id: 398243
Aligned: 41 rows
Threshold Bit Score: 272.916
Threshold Setting Gi: 56404857
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2R6Z_A              23 LVpvsQ--PPEQGSYLLAEHD-----TVSLRlvgEKSN---VIVDFTSGAAQYRRTKGGG--ELIAKAVNHTA--HPTVW 88 
WP_014704217        27 LT---VstTPTSSFILHLNAH-----GLSLS---APSSgnpLQVDFVSGKNAHRRLYGGGrnQPLARALGFKQgvSPVII 95  Methyloph...
goetting:Loa_02233  27 LR---V--DNQCLPRLQVTAE-----RLELLvegFSp----LYADFSTANWQRRH--AAGkhQGLVRACKPAKg--mTIF 88  Legionell...
Q5ZUG1              27 LQ---L--DQNADTCLFVTPE-----KLTLKirnFSl----MFADFSAMTWSKRR--GEGkrQGLIRACKPTKg--iKIL 88  Legionell...
P57646              23 LE---H--DQNCSMGLLINHN-----SLELYnrdNVNQk-pIKVDFTSKKNHYRCHHFRRknEVLYRVSGIKNsyFPTIL 91  Buchnera ...
Q1QZ91              23 WQ---AegDATAALRLAMTPE-----GLALSgeaRHYGa-pIRVDFTAGKAAHRRRFGGGrgQLVAKACGLARgvTPSIV 93  Chromohal...
Q47IZ2              18 LP---S--SGEADFVLQVGTE-----GLQLQelgPHAPg-pLSVDFVRGPLAHRRLQGGGsgQMIAKAVGIQPgvRPDVL 86  Dechlorom...
Q9HXW0              31 LP---LaaDDEAEFAVQVGEQ-----GLQVLqlgADSPg-pVRVDFVEGASAHRRKFGGGsgQMIAKAVGVQPgiRPRVL 101 Pseudomon...
jgi:Psefu_3533      32 LP---L--DGEAGYALQLGEA-----GLQLVelgPQAPg-pVRVDFVEGAVAHRRQFGGGagQMIAKAVGIAQgiRPRVL 100 Pseudomon...
Q6AL31              29 lniplsdrREEYPQALIWDRDglslcSISAKdgsHAKl---LYIDFMGGKNGYRHANDCTtrQPIAKAVGIKPgfRPTVF 105 Desulfota...
2R6Z_A              89 DATAGLGRDSFVLASLGLTVTAFEQHPAVACLLSDGIRRALLNPETQD-TAARINLHFGNAAEQXPALvkTQG---KPDI 164
WP_014704217        96 DATAGFARDAFVMASLGANVTLIEQHPIIAALISDGLTRGNADPAVAP-IIQRMSLHRANAVDYLQTL--SQId--WPDT 170 Methyloph...
goetting:Loa_02233  89 DVTAGWGRDAAILASFGACVVMIERNPVMAALLADGLKRLNAQSP----RALCLSLLSMDARQYLQTL--AIEa--YPDV 160 Legionell...
Q5ZUG1              89 DATAGWGKDAAILATFGADVVMLERHPVMAALLADALSRRNEADI----QKMCLSLIASDAISFLHSL--QEKd--YPDI 160 Legionell...
P57646              92 DATAGLGNDAFIFSFLGCKVIMIERHPIVAALLKDGLQRGYQDKKIGHwLQTRLHLIVNDSLKMLEIP--IL----QPDV 165 Buchnera ...
Q1QZ91              94 DATAGLGRDAFVLATLGAEVLLIERVAAIYALLEDGLGRASANAETAE-IAARMRVAQGDAARELASL--VARhdiAPQV 170 Chromohal...
Q47IZ2              87 DATAGLGRDAFVLAQLGCNVRLIERHPVIAALLADGLQRARLDPDVRP-IIERMHLQTGDAIQLMNAW--EGD---PPQV 160 Dechlorom...
Q9HXW0             102 DATAGLGRDGFVLASLGCEVTLVERQPLIAALLEDGLERARRDPDVAP-IAARMRLLGGNSADLMRAW--DGE---APQV 175 Pseudomon...
jgi:Psefu_3533     101 DATAGLGRDAFVLASLGCQVDLIERQPLIGALLEDGLQRAAADAEVAG-IVARMRLLQGNAIELMAGW--QGE---APQV 174 Pseudomon...
Q6AL31             106 DATAGMGGDGFVLACLGCRVTLCERSPIMYTLLQDGIERARQDSVMNK-IMANLDLIHNNSKQFLENH--GT----NYHT 178 Desulfota...
2R6Z_A             165 VYLDPXYPERRKSAAVKKEXAYFHRLVGEAQDEVVLLHTARQTAKKRVVVKRPRLGEHLAGQAPAYQYTGKSTRFDVYLP 244
WP_014704217       171 IYLDPMYPQRDKTALVKKEMQLLHQLVGTDQHSHDLLDIACQRARQRIVVKRPKSAAFLAQIKPVASITSKNTRYDIYKP 250 Methyloph...
goetting:Loa_02233 161 IYMDPMHPHRQKSALVKKEMQTLQQMIGADEDAVELLHLAKSCARQRVVVKWPQRIPPL--LTPAGSIEGKTVRFDIYs- 237 Legionell...
Q5ZUG1             161 IYIDPMHPERNKSALVKKEMQVLQQLIGTDHDAMELIELSLSHVKSRVVVKWPQKVKPL--LPPDASIDGKTVRFDIYMA 238 Legionell...
P57646             166 IYLDPMYPFHHKKSLPKKDMQFFRQLIGHNYDSKKLLEVSRKLAKNRIIVKRPYYAKPLSEDKVNHIVTTRNHRFDIYQP 245 Buchnera ...
Q1QZ91             171 VHLDPMFPHRDKSALVKKEMRVFRDLAGDDDDAPRLLEAALDVASHRVVVKRPRRAPPIEGPAPHHMLEGKTSRYDLYVH 250 Chromohal...
Q47IZ2             161 IYVDPMFPHREKSSLVKKEMSMLRPLVGDDLDASSLLEAALKLATHRVVVKRPRKAPSVLGPKVGYVLEGKSSRFDIYPK 240 Dechlorom...
Q9HXW0             176 VYLDPMFPHRDKSALVKKEMRLFRPLVGDDLDAPALLQAALALASHRVVVKRPRKAPIIEGPKPGYSLEGKSSRYDIYPK 255 Pseudomon...
jgi:Psefu_3533     175 IYLDPMFPHRDKSALVKKEMRLFRPFVGDDLDAPVLLEAALKLASHRVVVKRPRKAPVIEGAKPGYALEGKSSRYDIYPm 254 Pseudomon...
Q6AL31             179 IYMDPMYPHKKKSALNKKEMRVIRDLVGDDNDSDNLLETALTVAGNRVVVKRPKGAPYIEERKPHHEITMKNSRFDVYLT 258 Desulfota...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap