6RFL


Conserved Protein Domain Family
Pox_VERT_large

?
pfam04441: Pox_VERT_large 
Poxvirus early transcription factor (VETF), large subunit
The poxvirus early transcription factor (VETF), in addition to the viral RNA polymerase, is required for efficient transcription of early genes in vitro. VETF is a heterodimeric protein that binds specifically to early gene promoters. The heterodimer is comprised of an 82 kDa (this family) subunit and a 70 kDa subunit.
Statistics
?
PSSM-Id: 398240
Aligned: 10 rows
Threshold Bit Score: 711.874
Threshold Setting Gi: 81970516
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6RFL_K   3 YIVSPQLVLQVGKGQEVERALYLTPYDYIDEKSP--IY-YFLRSHLNi--QQPEIVKRHILLTLRMTQLKGYLGNLLDIK 77 
Q6TVN7 138 YTVAPQLVVLVGRHQEIERVLYLSLYDSVDEASP--IY-FFAKQYIQ---KDPEHVRRHILLTMRVRQLKGYLGSLLGLQ 211 Orf virus
P20636   3 YIVSPQLVLQVGKGQEVERALYLTPYDYIDEKSP--IY-YFLRSHLNi--QQPEIVKRHILLTLRMTQLKGYLGNLLDIK 77  Vaccinia virus WR
Q9QB84   3 YTISPQLVIYVGKGQEIKRALYLTPYGILDDKSS--IY-YFLKTHLNi--HNPEIHKRHILLTLKIRQVKGYLSNLLNIN 77  Yaba monkey tumor vir...
Q9Q8K4   3 YVVNPQLVLYVEKGQKIKRALYLTPYGTLDDKSP--IY-YFLSTHLKi--TDPEVHKRHILLTLKISQLKGYLCDLLRIR 77  Myxoma virus (strain ...
Q98277   2 YTVNPQLVVLVDRQQQLREVRYLSLYGTLDEASP--LY-YFAKQHLRa--ETLAVERRHILLTLKISQLKGYLCHLLGLR 76  Molluscum contagiosum...
Q9J562   2 YVVNPQLVVLVDKDQEILDVLYLTLYDGIDERSS--MY-YFIKNHLRvpmDRVRVLKKHIILTLKISQVKGYICDLLNID 78  Fowlpox virus strain ...
Q9EMU4  11 STINPQVIFLFDENKNVKKTIFLSKDSIIDNSFAygVYnYLLSTNTKf-lSQPEYINDHVILSFNLEQARGYIRNILRIN 89  Amsacta moorei entomo...
Q070C3   2 YKVSPQLVILAGPDQRIERVLYLTLYDAIDETAP--LF-YFVKNFLKa--ENVEVHRRHVLLTLKISQLKGYVRDLLGL- 75  Crocodilepox virus
Q08FP5   3 YIVSPQLVLYVGKGQEIKRALYLTPYGELDESSS--IY-YFLSTHLKi--TNPEIHKRHILLTLKIRQLKGYICNLLDIN 77  Deerpox virus W-848-83
6RFL_K  78 DDIIIYSHKNNLEYSYVDNTIFNPFVYTQKKTLLKND---SFLYNVYPGACDFLVIWVARAC--DTSIPEFGSY------ 146
Q6TVN7 212 DEIIVYSHKNNLEYSYVDNTIFNPFSPTQKKTLIRTD---GILYNAYADACNFLVVWVARAA--DTSAPEFGSF------ 280 Orf virus
P20636  78 DDIIIYSHKNNLEYSYVDNTIFNPFVYTQKKTLLKND---SFLYNVYPGACDFLVIWVARAC--DTSIPEFGSY------ 146 Vaccinia virus WR
Q9QB84  78 DDIIIYSHKNNLEFSYVDNTIFNPFTNTQRKTLIRSD---GFLYNIYPGACDFLVIWVTNSK--DTPMLEFGSY------ 146 Yaba monkey tumor vir...
Q9Q8K4  78 NDVIIYSHKNNLEYSYVDNTIFNPFAHTQKKTLIKSD---GFLYNIYPDACDFLVIWVADAE--DTSIAEFGSY------ 146 Myxoma virus (strain ...
Q98277  77 EDIIIYSHKNNLEYSYVDNTIFNPFTMTQKKTLIKAD---SFLYNVYVDACDFLVVWVARAQ--DTPVPEFGSF------ 145 Molluscum contagiosum...
Q9J562  79 EEIIIYSHKNNLEYSYVDNTTFNPFTMTQRKTLLKSK---SFLYNVYVDACNFLVIWVAKAA--DTMVKELGSY------ 147 Fowlpox virus strain ...
Q9EMU4  90 ENIILFSIWHNLDYYYNNNEIFDPYN-IKNNLLIESNdnkKILYMLDISITNGAIFCVTTNSytNTNLAKEGIYskiyte 168 Amsacta moorei entomo...
Q070C3  76 EEIIIYSHKNNLEYSYVDNTIFNPFTLTQKKTLIKLD---SFLYNVYLDACDFLVIWAARAA--DTAFAELGSY------ 144 Crocodilepox virus
Q08FP5  78 NDILLYSHKNNLEFSYVDNTIFNPFVHTQKKTLIKSD---GFLYNIYPESCNFLVIWVADAM--DTSIPEFGSY------ 146 Deerpox virus W-848-83
6RFL_K 147 --EDVDNNIIKFETMLMEVFPQLDLDITVESKFNNIFRTNLKLTGLKKIIQRVQDld--inYK-------SLLSRYDEHF 215
Q6TVN7 281 --EEPNDSILKFEERLIREFANLDLNMNVETKFNNIFRTNLRESGLRAIAQQSPD------KRaevgdfdILLSKTDDFF 352 Orf virus
P20636 147 --EDVDNNIIKFETMLMEVFPQLDLDITVESKFNNIFRTNLKLTGLKKIIQRVQDld--inYK-------SLLSRYDEHF 215 Vaccinia virus WR
Q9QB84 147 --EEVDSNILKFENHLLDVFNSLDLEMNIESKFNNIFRTNLKSTGLMTIIKKINEsd--tsYK-------SLLYKSDEYF 215 Yaba monkey tumor vir...
Q9Q8K4 147 --EDVDVNILKFETRLLEVFDDLDLDMTIESKFNNIFRTNLKFTGLRKLIKKINEfng-srYK-------SLLYKSDEYF 216 Myxoma virus (strain ...
Q98277 146 --EEVDANILKFEARLVEMFPELDLEFSIQSKFNNVFRTNLRSTGLRNIVKRNQD------NR-------ILFIKTDEFF 210 Molluscum contagiosum...
Q9J562 148 --EEVDANVLKFESRLIEMFPDLDLDFTVESKFNNVFRTNLKMTGLKNIVLSNTD------KK-------ILFIKSDEYF 212 Fowlpox virus strain ...
Q9EMU4 169 yiQEIIFNIYKNNYKLSSVVKESE-EYSLTNNFDDIIK-------LSNINKYKKT---------------LCIGVYDKYY 225 Amsacta moorei entomo...
Q070C3 145 --DEVDKNILKFEERLIGTFDQLNLNFSITSRFNNIFKTNIHATGLKRFIANNVD------RR-------MLLLRSDEYF 209 Crocodilepox virus
Q08FP5 147 --EDVDNNILKFESRLLEVFTNLDLEMTVESKFNNIFRTNLKFTGLNNIIKKINQlngklnYR-------TILYKSDEYF 217 Deerpox virus W-848-83
6RFL_K 216 INMTGNHFILND-----EQLNLSIW-DLDGTLALSSDGDTVMINNVKLFTDLVSDIDTQMERIKG----DITYKVHLATP 285
Q6TVN7 353 VSMTGTRFMLVD-----EPLNLSVW-GPEGDLVISSDGKTLTVNDVGLFTKLIESMDVKMDRVKG----DITYKVSLNTT 422 Orf virus
P20636 216 INMTGNHFILND-----EQLNLSIW-DLDGTLALSSDGDTVMINNVKLFTDLVSDIDTQMERIKG----DITYKVHLATP 285 Vaccinia virus WR
Q9QB84 216 INMTGNHFILTD-----EKLNLSVW-DSDSCLAFSSDGDTIVINNVKLFTELVSDINAQMERIKG----DVTYKVFLSTP 285 Yaba monkey tumor vir...
Q9Q8K4 217 INLTGNKFILTD-----ERLNLTVW-DSDGVVTFSSDGDTIMINNVKLFTSLLTDIDLQMERIKG----DVTYKIFLSTP 286 Myxoma virus (strain ...
Q98277 211 ITMSGNHFVLNN-----EALNLSIW-DAQGRLAISSDGDTITVNDVRLFTELVTDSNLQMERIKG----DITYRIFLLSP 280 Molluscum contagiosum...
Q9J562 213 INLSGNHFVIND-----ESLNLSIW-DDDGSLAISSDGNTITVNNVKLFTDMIPNNNVQMERIKS----DITYKVKLSTP 282 Fowlpox virus strain ...
Q9EMU4 226 IK--GDKISILDnyndsEYTSLYIYiDQNNIIKITND--VLITEKLTYFTDILKEEEIKNIIIKStspkSIIY-IYFDTF 300 Amsacta moorei entomo...
Q070C3 210 IKLSGNNFVLNN-----ERLNLSIW-DDNDQLLIVSDGESIVINDVELFTE-ISDEDVQLERIKS----DITYKISLTSP 278 Crocodilepox virus
Q08FP5 218 INMTGNKFIITD-----EKLNLSVW-DAEENLAFSSDGDTIMINDVKLFTSLLSDIDVQMERIKG----DVTYKIFLSTP 287 Deerpox virus W-848-83
6RFL_K 286 INSRIKLDIETSFIFIETATNNILLSSDKKISIILAKNHISIKVKNHIPNIEKYFTFLVIAINAMFNSVQKSADFTKVET 365
Q6TVN7 423 ITSKMKLDMETSFIFVETATNNILLSTDKRISIILAKSHVSVKVKNYIPNIEKYFTFLIVAISVMFNNVKQSSDFTKVET 502 Orf virus
P20636 286 INSRIKLDIETSFIFIETATNNILLSSDKKISIILAKNHISIKVKNHIPNIEKYFTFLVIAINAMFNSVQKSADFTKVET 365 Vaccinia virus WR
Q9QB84 286 ITSRIKLDIETSFVFVETATNNILLSADKKISIILAKNHISIKVKNYIPNIEKYFTFLVVAINSMFNSVQRSSDFTKVET 365 Yaba monkey tumor vir...
Q9Q8K4 287 ITSRIKLNIETSFIFVETATNNILLSADKRISIILAKNHISIKVKNYIPNIEKYFTFLVIAINSMFNNIQQASDFTKVET 366 Myxoma virus (strain ...
Q98277 281 ITSKIKLDIETSFIFVETATNNILLSADKKISIILAKNHISIKVKNHIPNIEKYFTFLVIFINRMFNAVQQAVDFTKIET 360 Molluscum contagiosum...
Q9J562 283 ITSKVKLDIETSFIFIETATNNILLSVDKKISIILAKNHISIKVKNHIPNIEKYFTFLVVFINRLFNTVKQSMDFTKIET 362 Fowlpox virus strain ...
Q9EMU4 301 LDSNINIQYDLKFFLNVTNTRNIFIDMSYKINIMTSKNHISFRSFNIDVNLCKYLSLLILGYNHIFNKIQKHARLKKIDE 380 Amsacta moorei entomo...
Q070C3 279 ITSKLKLDIETNFVFVETATNNILLSGDKKISIILARNHISIKVKNNIPNIEKYFTFLIIFLNRVFNVSQVSKDFTKIET 358 Crocodilepox virus
Q08FP5 288 ITSRIKLDIETSFIFVETATNNILLSADKRISIILAKNHISIKVKNYIPNIEKYFTFLVIAINNMFNNVQQSSDFTKVET 367 Deerpox virus W-848-83
6RFL_K 366 VYWSRICQNTKNKNRKPIIINYLDPG-MKKISNNFYRSDEK--------------------EVFINDNGIMFTCMDPLGK 424
Q6TVN7 503 VYWSRICQNTKTKNRKPVIVQSLDAD-MAKVSNNFFKSETR--------------------EVFVNGNGVMFSCMDPDGR 561 Orf virus
P20636 366 VYWSRICQNTKNKNRKPIIINYLDPG-MKKISNNFYKSDEK--------------------EVFINDNGIMFTCMDPLGK 424 Vaccinia virus WR
Q9QB84 366 VYWSRICQNTNNKNRKPVIVSSLDVD-MKKISNCFYKSKSL--------------------EVFINSNGVMFSCIDPMGK 424 Yaba monkey tumor vir...
Q9Q8K4 367 VYWSRICQNTKNKHRKPVIVSSLDED-MEKVSDNFYKSSTK--------------------EVFINSSGIMFSCLDPLNK 425 Myxoma virus (strain ...
Q98277 361 IYWSRICQNTRDKNRKPVIVSSLDAN-MERVSDNFFRSPTR--------------------EVFVNSNNIMFSCVDPLGK 419 Molluscum contagiosum...
Q9J562 363 IYWSRICQNTKDKNRKPVIISSLEPD-MLKVSDNFYKSPTK--------------------EVFVNNNEVMFTCDDKTGK 421 Fowlpox virus strain ...
Q9EMU4 381 LYPSRYCQNYKDVKRQPVLIDSIDENyLIKISDKYYVGKEDttrtyqhkgtkkifdpykygDVYIDDNGLIYQCSSIY-- 458 Amsacta moorei entomo...
Q070C3 359 IYWSRICQNTKTKNRKPVVVGSLDGD-MDRVAENFYEGGGR--------------------EVFVNDHDVMFSCIDPHQR 417 Crocodilepox virus
Q08FP5 368 VYWSRICQNTKNKHRKPIIISSLDFD-MKKISENFYKSDSK--------------------EVFINSNGVMFSCLDPLGK 426 Deerpox virus W-848-83
6RFL_K 425 YNKVGFLNIFHDMR--KYCIPCCFLHDQSHRSTFSSCVHQID-VEKKIVSPYILNFGKVV-TESKMSFLPIIFDAFLNDG 500
Q6TVN7 562 YNSVGFLSIFHRLQ--RICIPCCFLRSQAHTDTFKSCVYDEE-VDRSALNPYILNFGKVV-TESKLSFLPIIFDKYFNEG 637 Orf virus
P20636 425 YNKVGFLNIFHDMR--KYCIPCCFLHDQSHRSTFSSCVHQID-VEKKIVSPYILNFGKVV-TESKMSFLPIIFDAFLNDG 500 Vaccinia virus WR
Q9QB84 425 YNSIGFLSIFYKLQ--KMCIPCCFLKDQSHTDTFSSCVYNKD-VSNDIISPYILNFGKVV-TKSKISFLPIIFDSFLNEG 500 Yaba monkey tumor vir...
Q9Q8K4 426 YNYVGFLSIFYRLQ--KMCIPCCFLKNQSHTETFSSCVYQKE-IASDVINPYILNFGKVV-TKSKISFLPIIFDSFFNEG 501 Myxoma virus (strain ...
Q98277 420 YNSVGFLAIFYKLQ--KMCIPCCFLRSQAHTDTFISCVHHRE-LDRQLVSPYVLNFGKIV-TEAKISFLPILFDQFFNEG 495 Molluscum contagiosum...
Q9J562 422 YNNIGFLAIFYKLQ--KICIPCCFLKNQSHTDTFMACVHNKQ-TDKNIISPYILNYGKVV-TDSKIAFLPPIFNDFFNSD 497 Fowlpox virus strain ...
Q9EMU4 459 YSNMGFLNNIYLASggKTCYPCCYSKQKNRDEIFESCVYNKEiILEDKINPIIVNYGRIIlSKNGLSKLSPKLNNILNAN 538 Amsacta moorei entomo...
Q070C3 418 YMHLGFLNIFYKLS--GLCIPCCFLEAQKHSETFRACVFKTL-PLETCVSPYILNFGKIL-TPTKISFLPILYNNYFNKE 493 Crocodilepox virus
Q08FP5 427 YNNIGFLSIFHRLQ--KICIPCCFLKDQSHTETFSSCVHNKD-VIKDVINPYILNFGKVV-TKSKISFLPIIFDTFFNEG 502 Deerpox virus W-848-83
6RFL_K 501 MTANMEQDNKRLKETSGYHIVRCCAGdD-----IVRLRTTSDIIQFVNEDKNILIVNDMVYFPM----NASDigkkiHIL 571
Q6TVN7 638 LEADFEADNKRLRATAGYYVVHCCEG-A-----IVRLRTVSEIVSYVNASGNVLISGDMVYFPMrladTAAT-----RIL 706 Orf virus
P20636 501 MTANMEQDNKRLKETSGYHIVRCCAG-Dd----IVRLRTTSDIIQFVNEDKNILIVNDMVYFPM----NASDigkkiHIL 571 Vaccinia virus WR
Q9QB84 501 LRISFEQDNKRLKETTGYHVVKSCNG-D-----IIRLRTTSDIIAFVNDKNTILIADDIIYFPM----NYFSignniYIL 570 Yaba monkey tumor vir...
Q9Q8K4 502 VKIIFEQDNKRLKETIGYHVIKSCDE-D-----IKRLRTISDIIAFVNEDKNILIAEDIIYFPM----NYVDigtrvYIL 571 Myxoma virus (strain ...
Q98277 496 LRIEFEADHKRLKATDGYHVVKCCTR-Se----ITRLRTQRDIIQFVNAEQNTLIAGDMVYFPMhgarSAGAehqrvYIL 570 Molluscum contagiosum...
Q9J562 498 LSISLESDNKRLKSTKGYHVIRSCLH-NcryytLKRIRTKNDIIQFVNTENVTLIANDIVYFPM----KYSSinnkiYIL 572 Fowlpox virus strain ...
Q9EMU4 539 SKIDIVKHTNRIDFSDNYTIIMSYQP-T------ITIRNFDDMYYFIINNNAIVINDNIVYTDKsi-lKMNNnninvFII 610 Amsacta moorei entomo...
Q070C3 494 NAICFEVDNKRLRSTEGYYVVKALDD-Sv----IHRLKTESNIISFVDASCSVMIVNDLVYYPS----DVDKinnriHIL 564 Crocodilepox virus
Q08FP5 503 MKIIFEQDNKRLKETSGYHVVKSYDD-Dn----IIRLRTVSDIIEFVNTDKNMLIAEDIIYFPM----NYYDigkkvHIL 573 Deerpox virus W-848-83
6RFL_K 572 IQEIVHEVMIVKKKESSDKIDFFPPNYKLLKDLFPKQTIQTPIQ---SDAGMVLTTDGFYIDGKLFNEDLSSKYVTFTKN 648
Q6TVN7 707 IQEIVHDVVRIRKDAATDAIHLDQDASGRLASMFPHKAARRVVR---EENGLSLTTSGFFVDGKRFAPKLTSRFTAFVRN 783 Orf virus
P20636 572 IQEIVHEVMIVKKKESSDKIDFFPPNYKLLKDLFPKQTIQTPIQ---SDAGMVLTTDGFYIDGKLFNEDLSSKYVTFTKN 648 Vaccinia virus WR
Q9QB84 571 VQEIVHEVVLVKKKINKDVISTFSPNSIILRELFPKQTKSVTIR---SDSGMELTTDGFLIDGVKFNKDLSSKFMTFTKN 647 Yaba monkey tumor vir...
Q9Q8K4 572 IQEIVHEIVVVKKHMSKDAIEVFPPNYKLVKNLFPRQTKFITIR---SDSGMELTTDGFLVDGKEFNVDLSSNYVAFTKN 648 Myxoma virus (strain ...
Q98277 571 IQEIVHEVVMVQKAHDSDRIRFRELERNRLWEFFPYRVPSARIK---EEHGLVLTTDGFYVDGKLFSEPLSTRYVAFTEN 647 Molluscum contagiosum...
Q9J562 573 VQEIVHEIVIAKKEEDKDMIYFEELRTNKLRDMFPYKVKTVDIK---EQNGLKLTTDGFYVDGELFTEPLSTKRSVFMDN 649 Fowlpox virus strain ...
Q9EMU4 611 IQNRIHQLKNIDKQSKYDDIVVNKIDDKKIKIIKKYFNIISNIRnpiSNNGISITDDVCTIDGELIENK-NIKYFSEYNN 689 Amsacta moorei entomo...
Q070C3 565 IQEIVHEVVLVRKQLRSDRIAFLEPAENKLLRFYPYITDEVTIF---EGEGLRLTTKNFYVDGEPFTEPLSTKYTVYIVN 641 Crocodilepox virus
Q08FP5 574 IQEIVHEVVIVKKTLDKDNIDICPPNYNVIKQLFPKQLNSKSIR---SDSGMELTTDGFFIDGIKFDSVLSSNYVTFTKN 650 Deerpox virus W-848-83
6RFL_K 649 V-----IASDAV-AKYFSPLFKYVISEAKDRFIKTWMINIMIHMNVDPNN--I--IPTLEKYYP 702
Q6TVN7 784 A-----TVPNAV-SRHFAKLFRHVVTDAPDRFMKTWSVNCALKLGVEPDSarA--PALLQEFYP 839 Orf virus
P20636 649 V-----IASDAV-AKYFSPLFKYVISEAKDRFIKTWMINIMIHMNVDPNNi----IPTLEKYYP 702 Vaccinia virus WR
Q9QB84 648 V-----TTSDYI-SKYFSPLFKYVITESKERFIKTWVINIMLNFESDVNIesSviISRLEEYYP 705 Yaba monkey tumor virus strain VR587
Q9Q8K4 649 I-----TTPYTL-SKYFSPLFKYAITESKNRFMKTWLINTMLRLGIDLDLdtNi-LPKLEKYYP 705 Myxoma virus (strain Lausanne)
Q98277 648 V-----GTAGVA-AKYFAPVFKYVVTEARELFIKTWLLNVMMQLGLTGESsaAqtREALERYYR 705 Molluscum contagiosum virus subtype 1
Q9J562 650 I-----STQNNPiVKYFNSVFKYVVTDNKEIFIKTWVINTMLKLGIGKDYthIqiKSILEKYYK 708 Fowlpox virus strain NVSL
Q9EMU4 690 IslkpkSTSEYI-EKYFKQYFDTIYTNNIRLFIKIFITKIMHSIKETDIIktD--YTKLEEKLN 750 Amsacta moorei entomopoxvirus
Q070C3 642 V-----NPLNTQvYKYFSRFFKFVVTNNLEIFIKTWVINILLRLGAPPTVg----RSTLEKYYK 696 Crocodilepox virus
Q08FP5 651 I-----TTVPSI-TKYFSPLFKYVVTESKERFIKTWIINIMLNLGIDIDIdsNv-IQKLEKYYP 707 Deerpox virus W-848-83
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap