2PBE


Conserved Protein Domain Family
Adenyl_transf

?
pfam04439: Adenyl_transf 
Click on image for an interactive view with Cn3D
Streptomycin adenylyltransferase
Also known as Aminoglycoside 6- adenylyltransferase (EC:2.7.7.-), this protein confers resistance to aminoglycoside antibiotics.
Statistics
?
PSSM-Id: 398238
Aligned: 52 rows
Threshold Bit Score: 244.38
Threshold Setting Gi: 493385301
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2PBE_A           10 XDIFLDFALNDERIRLVTLEGSRTNRNIPPDNFQDYDISYFVTDVESFKENDQWLEIFGKRIX--------XQ--KPEDX 79  Bacillus sub...
Q830C7            8 FQLIMDVAKQEEHIRAVGMVGSRTNVKAPKDSFQDFDIVYIVEPCAEFFETATWIAKFGQPLI--------MQ--RPKEM 77  Enterococcus...
BAK93575          8 TDLILETAQKLPEVKAVAMSGSRANKSIPKDNFQDFDITYIVDDIDPFIKNRQWLDKLGKRLI--------MQ--TPDEM 77  Tetragenococ...
WP_015509579      8 HQLILSVGQRV-GARAIGLSGSRTDPQAPKDFLQDFDVVYVMDDIQPLVDDPSWLEAFGPIMI--------RQ--TPEAS 76  Enterococcus...
EQC80490          8 LAVILRVGQKI-GVQAIAISGSRREPNAISDRFQDYDIVYIVDNMQELIAEPSWLEEFGQIMI--------MQ--TPESS 76  Enterococcus...
CCX38240          8 YQLILEYAWKDPKIRGVILNGSRANPTAKLDRFRDFDIVYLVTDVTPY-KQGDISPAFGELLV--------MQ--RTDEM 76  Clostridium ...
jgi:Clocel_2181   8 MDLILNIAKEDARIRAVYLSGSRVDPDATQDKYSDFDIVYIVNEIQSFTKDDHWLDQFGDRLI--------MQ--KSVDW 77  Clostridium ...
WP_013281084      8 YDLIIKTATEDDRIRAATMEGSAVTPGAVRDGFSDFDITFFVSDIREFTADKNYMRKFGDILI--------MQ--TPDDW 77  Butyrivibrio...
adrc:B739_0034    8 LRTIIEWSEKNEDVRVLLLTSSLVNPLALVDEFSDLDIEFVFEDNTNYISDKSWTLKFGNPIA--------MI--EEDE- 76  Riemerella a...
WP_006341522      6 vtkIVEWAKQEQTVKAVILQGSHATNQA--DRYSDYDLSLFCTEIETFTYNDTWLSAFGNVWIcvheklclAQqiVPTR- 82  Parachlamydi...
2PBE_A           80 ELFPPELG--NWFSY-----IILFEDGNKLDLTLIPIREAEDYfaNNDGL-------VKVLLDKDSFINYKVTPNDRQYW 145 Bacillus sub...
Q830C7           78 TLFPTEPK--TRETF-----LMLFEDGQRIDLTLCPLAEKDNWh-EGDSL-------AIILLDKDENLPPLPVASDKNYT 142 Enterococcus...
BAK93575         78 GLRANKAE--EKFTF-----LMLFEDGNRIDLTLCSTSGIHPWl-ANEPV-------LKVLSDPYHLLTDVPDVSEKVYQ 142 Tetragenococ...
WP_015509579     77 TIYPPSLG--GCFTY-----LMHFLDGVRIDLMLCPLALVDRLa-NEPGL--------QPLLDPDQILSFVNQANHSHYW 140 Enterococcus...
EQC80490         77 VLSQPSLG--GRFTF-----LMHFEDGNRIDLMLCPVELIHLL--QAEPF-------LERLYDPKELLQGMTVPNASIFW 140 Enterococcus...
CCX38240         77 ELFNDHYP--HLAVY-----LMQFTDGNRIDLTIARVEDYHSYc-YDDRL-------SIVLLDKDGFLPQLPSPDESTHG 141 Clostridium ...
jgi:Clocel_2181  78 YSHQYDYNsnEDFIY-----LMQFLDGNRIDLTLVDIENVKRRi-NDKEP-------RIILLDKDGIDGLHNIEVKDYYY 144 Clostridium ...
WP_013281084     78 YMEPYDYNgkKRFAY-----LTQYKDGNRIDLTFIDVSEIGKQt-DFNEP-------RTILINKDGFTELKEITSGDIFF 144 Butyrivibrio...
adrc:B739_0034   77 ----------SCFNHkhamkMLLYEDGVKVDFKLYSKSKFIKEt-QEKELpedwdigYKILIDKDGITKQMLKPTYQISI 145 Riemerella a...
WP_006341522     83 --------------------LVIFEDGIKVDFTLFSPDILRTVhcLPP---------FKILVDKENMLK---NVENEAYE 130 Parachlamydi...
2PBE_A          146 IKRPTAREFDDCCNEFWXVSTYVVKGLARNEILFAIDHLNEIVRPN-LLRXXAWHIASQKGYSFSXGKNYKFXKRYLSNK 224 Bacillus sub...
Q830C7          143 VTVPDQQQFNDCCNEFWWVSTYVVKGLCRNELFYAVTHLYEYCQQE-LLRLLSWQAAWQEPEPISVGKQFKYLKNYVTPD 221 Enterococcus...
BAK93575        143 IFPATQTAFAECCNEFWWVSTYVVKGLVRGELLYASDHLYTICQKE-LLRLLSWEAVLQKG-PLNPGKNYKYLFNFLPLK 220 Tetragenococ...
WP_015509579    141 IKRPTQAAFQEHCNEFWWVSTYVVKGLLRKQLIYAADHLYTICWQE-LLWIEDLFVAQAQQFQVSTGKNHKYLQSFLTEK 219 Enterococcus...
EQC80490        141 IKPPTEKTFHDSCNEFWWVATYVVKGLVRNQLFYAADHLYQICWQE-LLRQYDWYLAHQADYRLSTGKNHKYLQSYLSEE 219 Enterococcus...
CCX38240        142 IQRPNPRVFEECRNEFWWTAPYVSKGIWRGQLLYAQQFLENCTRKM-LRLMLSWQVGTEHGFPVYAGKAGDGLEKYLPPK 220 Clostridium ...
jgi:Clocel_2181 145 IQKPSKEEFRDCCNEFWWLNTNIAKGLCREELMYVKFFMEHYQMDM-FLKMLNWKIGIEYDFSVSTGKCYKYFKRYLSDS 223 Clostridium ...
WP_013281084    145 IQKPSEFEFYNTVNEFRWVSNYATKGLCRHQFYYAKYSMEHLMMNM-FMKMINWKVGIDNDFKVTTGSFSKYLRKYLTED 223 Butyrivibrio...
adrc:B739_0034  146 IKKPSEKEFQNLINDFWWDTTYVAKCLVRDEIFYAKFMSETVIRTEyLIPLIEWHIASEHNWNITTNKYGRLFKKYLNQE 225 Riemerella a...
WP_006341522    131 RDNPSLQQFVRCIKEFWFEAYHVAIALKREDLWNAKFRFEAI--DAfLLQMIEWHASALNEGQ-QILHGGKWMRSWVTPC 207 Parachlamydi...
2PBE_A          225 EWEELXSTYSVNGYQEXWKSLFTCYALFRKYSKAVSEGLAYKYP-DYDEGITKYTEGI 281 Bacillus subtilis
Q830C7          222 TMDQLASLLDFSSKEACWNSLIKTQAFFDVVAQDFAKMAQFTYHlQEAKKVTEYTNSL 279 Enterococcus faecalis
BAK93575        221 Q-APFEKLLNFSSINLCWQSLLATQDFFHSEAQNFAQAAGFDYMnTVAENIMDYTQEH 277 Tetragenococcus halophilus NBRC 12172
WP_015509579    220 EWRELTSLLDFSTITACGQSLLKMQKRFDGQAKNISEKLGLAYDwQEAENVQTYTKYw 277 Enterococcus casseliflavus
EQC80490        220 EYERLTA-LCFSSVETCGESLWKIVQLFDEIARYVSRQHQFLYHeEEASKVMKYVQKW 276 Enterococcus sp. HSIEG1
CCX38240        221 TWEHYLSTYSPCQKDALFEALFSACELFTQTSKKTAQALGYTLEdRWDETVPQFMKET 278 Clostridium sp. CAG:1013
jgi:Clocel_2181 224 DMDRFTNLFPNGEYKEIWDKLLKICEFFHELAITVSTHFNFEYSkEEAENVIEYLKRM 281 Clostridium cellulovorans 743B
WP_013281084    224 EMKRFEGIFAGGAYEDMWDKVFLMYDYFEDLSIYVADKLGFSLDlEESSNVREFMKKR 281 Butyrivibrio proteoclasticus
adrc:B739_0034  226 MWAKTEQTFSGSDIKENWTALFSMTDLVSEIGTELSKKLEYKYPdKLENDIRKYLAGL 283 Riemerella anatipestifer RA-CH-1
WP_006341522    208 CWEYIQKISSLPSVS--WERLDETMQLFRLLATETAFKWHYLDAlDLDFNISHYISSL 263 Parachlamydia acanthamoebae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap