5FNP


Conserved Protein Domain Family
ScdA_N

?
pfam04405: ScdA_N 
Domain of Unknown function (DUF542)
This domain is always found in conjunction with the HHE domain (pfam03794) at the N-terminus.
Statistics
?
PSSM-Id: 398212
Aligned: 51 rows
Threshold Bit Score: 67.5511
Threshold Setting Gi: 119377524
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5FNP_A          5 DQPLGELALSIPRASALFRKYDMDYAAGGKQTLARAAARKELDVEVIEAELAKLA 59 
Q81RA3          8 tSIVGEIVTQFPKASDLFKSYRIDFCCGGNKPLIDAIHERNLSATEVITELNTLY 62  Bacillus anthracis
Q65IY9          8 NTKTGDIVTRFPRASRLLKEYRIDFCCGGNRPIGEAIKEQDLNEEEILARINTLY 62  Bacillus licheniformis DSM 13 = ATCC 14580
Q97MW9          8 NQKIGDIVVKFPRAIEILKRYKIDFCCGGDRVLEEAIKEQGLNGQEIIDEINEDY 62  Clostridium acetobutylicum
Q8XMB4          8 DYSLGEVVTVYPAVVKKFNDMELDYCCGGNKSLELALKEKGVDVDKFVEDLNKef 62  Clostridium perfringens
WP_012065367    8 EDKVGEIVAKCPKASEVFQKYQIDFCCGGDRSLRVVLQEQNLNEERVLSALTEAH 62  Alkaliphilus metalliredigens
WP_003515331    7 SQRVGEIAAIMPKASEVFREFNIDFCCGGHRTLAEVIKTENIDEQQLLKKLEDAY 61  Hungateiclostridium thermocellum
jgi:Clos_2425   8 NDKIGDIVVRLPKASEVFKTLQIDFCCGGNRPLIEAIKEQGLDENTVLSKLQGAY 62  Alkaliphilus oremlandii OhILAs
EAY13975        6 ERTVGSIVAESFKSASTFAKFGIDFCCHGYNKLNVACKEAGVSLEDVYNELNKPA 60  Trichomonas vaginalis G3
EAX94302        8 QQSVGSIVANSFSTANVFAKFGIDFCCHGYVKLLDACKTAKVPLDTVYDALMENE 62  Trichomonas vaginalis G3
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap