Conserved Protein Domain Family
DUF535

?
pfam04393: DUF535 
Protein of unknown function (DUF535)
Family member Shigella flexneri VirK is a virulence protein required for the expression, or correct membrane localization of IcsA (VirG) on the bacterial cell surface,. This family also includes Pasteurella haemolytica lapB, which is thought to be membrane-associated.
Statistics
?
PSSM-Id: 398204
Aligned: 41 rows
Threshold Bit Score: 243.272
Threshold Setting Gi: 123336771
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
wugsc:KPN_02355   35 IWRQKNYRFKFLLRTALFYNATRAMLEALS--ARDDFNQLLAAQATLPGKVHRQYLTRDLNAWQRAVAVINHYRYIDTLR 112 Klebsiella ...
Q9CML1            20 KLKRFREYLRYQYAYRLYHKQCGQFDQFLN--QHPLWIPLFQQHPYRVNGLLSTYCNRRWGGSQRLQAITTNLMVATAKF 97  Pasteurella...
jgi:Asuc_1554      8 LGKRIRSFFRYHFYMQRYKAEMREFVQYLQ--QHPQWLPVFEQNGYRFNALLAKFCDRRFSVRQRLSVMKYAFDCAEQCW 85  Actinobacil...
WP_012341125      19 FLKRLRTRIRYYFYRLTCFKECQIFVTYLN--HNPLWIDIFTKSYYRCDAVLRKYCDNRFNKKQRVQAIMDNFSVAEQVF 96  Histophilus...
Q57144            24 FLKQVREKLRYYGYKWLYQKQCSQLVDFLN--TETQWQSLFTQDYYRTNTILTTFCDKRFSASERLTAITENLRLAEEKM 101 Haemophilus...
Q0P9I5            17 KSIIFWRYLRFQARKILYFPQVRLLEKTLNkeKNKHLKDFFSQRPYACYNATRRFCDKSFKANERVKTLIYDVD------ 90  Campylobact...
Q7VLT2            17 QKSYRWKRLRFNIRSLWHAKYIKKFTAFAN--QQPELATFLNSRANYSYPLVHRFLDKRWNAEQRLTAICDNLTFLTQKF 94  [Haemophilu...
USMARC:WQG_16920  20 NKSYRFKRLRFRLRSLMNLRSVQAFEQYVN--QNPDLAAFLNTRANYSYPLVHRFLDKRFNAKQRYQAMVDNLTFLPKS- 96  Bibersteini...
WP_010786979      20 KKSYRLKRFRYRFRSILHRSLIRKFEHKIN--SESSLKPLLIKRADYSYPLVHRFLDKRFNSQRRFNMICDNLDFLPKVL 97  Glaesserell...
Q9CKU4            20 KKSYRLKRFRFHLRSLLHQGNIKRFEQFIN--QHPTLAGLLNSRPSFSYPLAHRFLDKRFSTKQRFAAICENLRFLPEKF 97  Pasteurella...
wugsc:KPN_02355  113 GsRLAHAMTAVSEVPLLTlngkEDRRFTLYAsSAGKAEREGETTLWLRD-SDhTLLASATFSVTrdhDAWQLVIGGLQGP 191 Klebsiella ...
Q9CML1            98 GvERCQHLLEKGTLILAT----LTDSLSLNLnINTIDPFEGFFSLNIQNtETkQSVYDASFTFL---SEKQLLIASIQGP 170 Pasteurella...
jgi:Asuc_1554     86 GsENCRRLVAQQSLLLAQ----LTENWGVYLnINAIDPFEGFFSLNIKN-REgRSVYDASFTFL---PENRILIASVQGP 157 Actinobacil...
WP_012341125      97 GrSFSQLLVEKDKVLLAE----LTDELDLYLaINQIDPFEGFFAVNIRN-KQgQRIYDASFSFL---AGNKLLITSVQGP 168 Histophilus...
Q57144           102 GrSLCQQLLDQQHIVLTQ----LTEDLRLSLsINHIDPFEGYFSINIRN-QNnERVYDSSFTFL---SPNKLLIASIQGP 173 Haemophilus...
Q0P9I5            91 KgLACFKFLPEEQIIFS-----FDEDFELFLgYNYNVCEEGFWAFSLKF--KkYTILQCNFCFT---LENNLLLSCIQGH 160 Campylobact...
Q7VLT2            95 AtQQLTPLLQQ-KICFGE----VAEDFAIYLnINEQQPMEGFWALELRQqSTqSLIYLLTFGKV----ADDLLIAAIQGT 165 [Haemophilu...
USMARC:WQG_16920  97 -------LWQQ-SISFGE----VVPEFSLYLnINEQQPMEGFWALELRHsETnQLIYVLTFGKL----ADSLLIAVIQGP 160 Bibersteini...
WP_010786979      98 LsKNLPQLWDS-PICFTE----VIEDFEIYLnVNEYQPMEGFWALELRYkPSgQLVYLLTFGKL----ENALLIAVIQGP 168 Glaesserell...
Q9CKU4            98 TaLGLPQLWEK-EMCFGE----VIEDFELYLcLNYHQAMEGYWALELRYkPTgQLIYLLTFGKV----EQSLLIAVIQGP 168 Pasteurella...
wugsc:KPN_02355  192 RRHVS--HEVIKQATRACYGLFPKRLLLEFIWQLAARSQIAAIYGVSDNghvfRALRYRLSKGRHFHASYDEFWQSIDGQ 269 Klebsiella ...
Q9CML1           171 KGEHA--PEIVRVVTKQLHGVRPMFMLVNGFRFLAQQLDC-QLLGIPHR----QQAKYRWNDSERLLFNYDEFWQENDAv 243 Pasteurella...
jgi:Asuc_1554    158 NGAEA--QELVKTATKQLHGMRPMYMIVHVFRTLADVLAY-ELLGIAHK----NQAKFRWNDHSKLLFNYDEFWRENEGA 230 Actinobacil...
WP_012341125     169 SDDNS--QELIKSTTKQLHGVRPMFMLVNVYKLLAKELNC-ELLGIAHK----NQGKYRWNDNARLLFNYDDFWQENNAL 241 Histophilus...
Q57144           174 SSDNA--QELVKQATKALHGMRPMFMLVNGFKMLAEKWQC-ELVGIPHK----AQGKYRLSARSKILFNYDEFWQENQGE 246 Haemophilus...
Q0P9I5           161 KYKDFniLEINKILTKKCHGLRPVALLIECSKMLCEILKLQATLGVHEK----NQIRSQKGKEKGYFVDYQKIWLENGGE 236 Campylobact...
Q7VLT2           166 NTENG--KDIIKQLTKQCHGLRPAYLMVEVMRLLTQALGYKQLLGIPHK----YQNKSRLIQSKRYFVDYDTIFRESGG- 238 [Haemophilu...
USMARC:WQG_16920 161 NFDGS--KELVKKLTKKCHGLRPAYLMVECMKALTRVLGYSTLLGIPQK----YQNKSRLIQSKRYVVDYDAIFSESGA- 233 Bibersteini...
WP_010786979     169 NFEGS--KELVKQLTKKCHGLRPAYLMVEAMKALTQVLGYSKLFGIPQK----YQNKSRFVQSTRYFVDYDTIFKESNG- 241 Glaesserell...
Q9CKU4           169 NFEGS--KELVKVLTKKCHGLRPAYLMVEVMKALTHALGYDKLLGIPHK----YQNKSRLVQSKRYVVDYDAIFAESAG- 241 Pasteurella...
wugsc:KPN_02355  270 P---ESPwRWRLPLCLERKSLESIASKKRAEYRRRFQLLDQLTEQVA 313 Klebsiella pneumoniae subsp. pneumoniae MGH ...
Q9CML1           244 ----KQGeYWCLPADVERKPLEDIQSKKRSMYRKRYEMFDNALEQII 286 Pasteurella multocida
jgi:Asuc_1554    231 L---DEEgYWRLPLEVERKPLEEIQSKKRSMYRKRYDMFDSIQRSVR 274 Actinobacillus succinogenes 130Z
WP_012341125     242 L---NPQgYWQLPVVIERKTLEDIQSKKRSMYRKRYEMFDFIEKNIT 285 Histophilus somni
Q57144           247 Y---RHN-YWQLPLHIERKQLEDIASKKRSMYRKRYEMLDQMALDIQ 289 Haemophilus influenzae Rd KW20
Q0P9I5           237 LikiNKHkYYKL--HHSQKNLEEIPSQKRSMYKKRFAMLEEIKTNLD 281 Campylobacter jejuni
Q7VLT2           239 ----YLTkYWQLPLTID-KDLTHIASKKRSMYRKRFAMLEQLAQQIN 280 [Haemophilus] ducreyi
USMARC:WQG_16920 234 ----SLAeYWLLPLALNNKDLSDIPSNKRSMYRKRYAMLEQIQAAMH 276 Bibersteinia trehalosi USDA-ARS-USMARC-192
WP_010786979     242 ----ELKeYWELPLTLESKNLEDIPSNKRSMYRKRYTMLNHLLRAIA 284 Glaesserella parasuis
Q9CKU4           242 ----ELKdYWELPVQFAMKDMDSIPSNKRSMYRKRYAMLEQLQANMK 284 Pasteurella multocida
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap