Conserved Protein Domain Family
RdgC

?
pfam04381: RdgC 
Putative exonuclease, RdgC
Members of the RdgC family may have exonuclease activity. RdgC is required for efficient pilin variation in Neisseria gonorrhoeae, suggesting that it may be involved in recombination reactions. In Escherichia coli, RdgC is required for growth in recombination-deficient exonuclease-depleted strains. Under these conditions, RdgC may act as an exonuclease to remove collapsed replication forks, in the absence of the normal repair mechanisms.
Statistics
?
PSSM-Id: 398194
Aligned: 109 rows
Threshold Bit Score: 255.493
Threshold Setting Gi: 502586141
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_015281914        2 FKNARLFRLREPFTLDAATLEEQLRSRCFRPCGPLE--TVTLGWTTPCPQQDGGgpLVHTLAEYLLICARRQERLLPAAV 79  Thioflavic...
Ansesd:TEQUI_1460   3 FKNLKLFNLNPDWSVSALKLHEMLKTYTFEEGNFIDsgMANVGWTKIHEEYESEhdLVLEVGHHLITKFKYEKKLLPTSV 82  Taylorella...
BAN36173            3 FKNIFLYRLPADlaiSAATLEEKLSRQPLQPCGGLD--KQSRGWVSPQGNGP----FVHALNRQLLIAMGVEQKLLPAAI 76  Sulfuricel...
WP_013292184        3 FKNIFIYRLPVDcaiTAAALQEKLALKPLLPCSGLD--KQSRGWVSCRGDDR----LVHAANGQILFALGVEQKLLPATI 76  Gallionell...
WP_013147543        3 FKNAFIYRLASQnsiTPDVLNEELTLRPLLPCSGLD--KQSRGWVPCHSEK-----LVHSVNKQILFALGVEQKLLPTTI 75  Methyloten...
jgi:Mmol_1120       3 FKNTFIYRLATDstiTHDQLLEKLSEKPLLPCGGLD--KQSRGWIACHSDK-----LVHHGNGQLLFALGVEQKLLPATI 75  Methyloten...
Q5NFX9              3 FKNLTAFKITDI---NIDIFEDSMNKLAFIPCSNPQ--KSSRGFINPFIKDEN---CLFKFNHLAAFCLLTEEKILSAQV 74  Francisell...
WP_012823905        3 FRQLSVYRLESECP-DFSTLNTALKEHPFSPTRPQQ--AESVGWQTAIGEQY-----VHETDGAARIVLQREERSVPSSV 74  Halothioba...
Q5ZW99              5 FNNALMFQYKLD---GGCDLNHSLTEEALKPCPPHA--RFTYGWVPAFEQE-----MVHEVAGSTLICLGKEERILPRGV 74  Legionella...
CBJ11653            3 FNNALIYQYELD---DTCDLAVSLAENILKPCPPHA--RFVYGWLPLIADE-----MIQEIAGSSLICLGKEERLLPRGV 72  Legionella...
WP_015281914       80 VAEALEERVGEIEAEEARSIGRAERRRLREAIMTELLPRAFTRSRRILAYVDPAAGWLVVDAASDKIAEELVSLLRETLG 159 Thioflavic...
Ansesd:TEQUI_1460  83 INQFTKEKALELEEEQGFKPSKKKLKEIKEFVTDQLRPKAFSIFKEVWVVFDIENSIFWMDTTSNSLADDIVTLMSKCLS 162 Taylorella...
BAN36173           77 INQFAKDRIAELEAQQGHRVGRKEIKEIKERITDELLPRAFAHRRTTFVWIDPVNGWLVVDAASPAKADEVLELLGKTLD 156 Sulfuricel...
WP_013292184       77 ITRFAKERVADIEAQQGYKVGRKEMKDLKEAITEELLPRAFALLRTTYAWIDTANGFLVIDAASAAKAEELLEFLNKTLD 156 Gallionell...
WP_013147543       76 INRFAKERAAEIEAQQGYKVGRKEMKELKESITEELLPRAFSLQRTTYAWLDTVNGYLVIDAASSARVEELLELMNKSLD 155 Methyloten...
jgi:Mmol_1120      76 INRFLKERVTEIEAQQGYKVGRKEKKEIKEAVTEELLPRAFALQRTTYAWLDPINGYLVIDAASSTKAEELLEFFNKSIE 155 Methyloten...
Q5NFX9             75 INQQAQEYIEELELTR--YVSKKEKTQIKEDMQQKLLPLAFSKFRKTYGYLDLTNNYLVIDSISEKQITEILDLLHRCEA 152 Francisell...
WP_012823905       75 VRDMADQRLLARAGTTG-EPSKAEKIAMRDAVLLELLPQAFPRQSNTQAIIDRKNQQVWFDTLTATKIERTSNQLREQIG 153 Halothioba...
Q5ZW99             75 INKMLKEKIQQIEAAQGRPVKRAEKAQMAEDLEFELLPKSFCVQKKLLAILDSVSQRLIINTSSNNQASQLTSFLRKSIP 154 Legionella...
CBJ11653           73 INKMLAEKVQLLETQQGRMVKRAEKAQMAEDIEFELLPKSFCVQKKLLAILDSSSKRIIVNTSSPNQAAQLTSFLRKSVA 152 Legionella...
WP_015281914      160 SL-PATPPRPETTPTTRMTDWLASG-SGPGGFELGDACELRDPQDS-QSVVRCRGQDLASAEIATHLHAGKQIVQLALAS 236 Thioflavic...
Ansesd:TEQUI_1460 163 PL-PLTNFQTAISPTSAMTTWIVEG--APSPFSTEQDTELKGILDS-KISVRYANYNPDITEIRNHLNSGKICTKLSLNW 238 Taylorella...
BAN36173          157 DL-PLKLLHTRLSPVAAMTGWLAAG-DAPPGFTIDRELELRSIDEG-KATVRYVRHDLEGDEIRAHIAAGKSATRLGMTW 233 Sulfuricel...
WP_013292184      157 DL-PVKPLHTELSPVAAMTDWLAGE-AAPAGFTIDRELELRATGES-RATVRYANHALEGDEILAHIAAGKRATRLGLTW 233 Gallionell...
WP_013147543      156 NL-PFKQLHTAISPVAAMTDWLAGN-NPPAGFTIDRELELRATGES-KATIRYANHELEGEEILKHIAAGKRVTRLGLTW 232 Methyloten...
jgi:Mmol_1120     156 NV-PFKQLHTNVSAVSAMTDWLASG-NAPSGFTIDRELELRAAGEG-KATIRYANHALEGDEILKHIASGKRVTRLGMTW 232 Methyloten...
Q5NFX9            153 RFeP-----VIKEETDILTEWLVDN-AYPVDIEIAEKCKLTSAIGDsIANISCQGSSMLNDNIKSFIDSGGYITEIAIIW 226 Francisell...
WP_012823905      154 QW-RMVPFFGIQDISAHLASWLLG--TPPTGFDIGEGAKLVDLRE--GGTVTVSKLALPDPHVVAHLHEGMKVDQLELIW 228 Halothioba...
Q5ZW99            155 GI-VIEPLNLTENLALRFAEWIHSPaTLPDDFQLASDCLLFSLEDE-KKRVHCKGYELPAEEILTLLAQGMGTAEISLIW 232 Legionella...
CBJ11653          153 GI-SIEPLSHTENLALRFAEWIHSPeTLPQHFQLASDCLLFALNDE-KKRVHCKGYELPAEEILTLLSQGMATAEISLIW 230 Legionella...
WP_015281914      237 TDRLDFVLTDDLALKRLRLADGLLDDLAEGDS-EDPIVRFEAELTILVASIGEVLERLTELFE 298 Thioflavicoccus mobilis
Ansesd:TEQUI_1460 239 NDKIVFTLNDALDIKKITALNLAEDIEKS----DDKFEVFLSEISLMASELSSMIMDLSEVLN 297 Taylorella equigenitalis MCE9
BAN36173          234 NDKISFVLTEQLQIKRLAFLDILKEEAESE-A-ETTEELFDIDFTLMTGELARLLADLVEALG 294 Sulfuricella denitrificans ...
WP_013292184      234 NDRVSFVLTEQLQIKRLEFLDIIKEESTTL-A-DTADELFELDFTLMTGELAKMLVDLTDALG 294 Gallionella capsiferriformans
WP_013147543      233 NDRISFVLTEQMQVKRIEFLDIIKNESTEM-A-ENADELFELDFTLMTGELAKMLADLTNALG 293 Methylotenera versatilis
jgi:Mmol_1120     233 NDRISFVLTEQMQIKRLEFLDIIKEDVTTL-A-EDADEIFALDFTLMTGELAKMFTDLTHALG 293 Methylotenera mobilis JLW8
Q5NFX9            227 REQLAMTVNTKLQFKAIKFLDGIKDLN------KEDNSGHEVDLLLMADIFAELINTMQNWIV 283 Francisella tularensis subs...
WP_012823905      229 REQIRFTLRADGGLAKIKPTE-LLDTDDSGEMiDDADQQLDADQRLMVGALRQLIQDLANVLK 290 Halothiobacillus neapolitanus
Q5ZW99            233 KERIQFTLTQDFTFKKLKSLDYLIDDFNEIRQlEEEYQRQDAALTLLSGELRELSNGLMKIFV 295 Legionella pneumophila subs...
CBJ11653          231 KERIQLTLTHDFTFKKLKSLDYLIDDFNEIKQlDEEYQQRDAALALLSGELRELINDLLAALI 293 Legionella longbeachae NSW150
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap