6QDX


Conserved Protein Domain Family
RsmJ

?
pfam04378: RsmJ 
Click on image for an interactive view with Cn3D
Ribosomal RNA large subunit methyltransferase D, RlmJ
RlmJ is ribosomal RNA large subunit methyltransferase J is required for full methylation of 23S ribosomal RNA (rRNA) during ribosome biogenesis. The ribosomal RNA of E. coli carries 24 residues that require methylation, and this methyltransferase is the last to be described, that modifies A2030. RlmJ displays a variant of the Rossmann-like methyltransferase (MTase) fold with an inserted helical subdomain. On binding cofactor and substrate a large shift of the N-terminal motif X tail is induced in order to make it cover the cofactor-binding site and to trigger active-site changes in motifs IV and VIII.
Statistics
?
PSSM-Id: 398191
Aligned: 6 rows
Threshold Bit Score: 356.77
Threshold Setting Gi: 81535698
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6QDX_D  36 DKPFLYLDTHAGAGRYQLGSEHAERTGKYLEGIARIWQQDDLPAELEAYINVVKHFNRSGQ--------LRYYPGSPLIA 107 Escherichia coli
P31777  33 EKGFFYLDTHSGVGRYRLSSNESEKTGEYKEGIGRLWDQTDLPEDIARYVKMIKKLNYGGKe-------LRYYAGSPLIA 105 Haemophilus influenza...
Q9KVF9  33 EKPFVYHDTHSGVGRYDLTHEWSEKTGEYKQGIARIWQQDNIPAELDSYLDAIRQLNQGET--------LRYYPGSPRVA 104 Vibrio cholerae
Q9HUF0  32 DTPYAYLDSHSGVGLYDLQGDEASRTGEWEQGIARLWEREGLPEQLDDYLDVIRHLNPDGS--------LRYYPGSPELA 103 Pseudomonas aeruginosa
Q9PHA1  32 ETPFFVLDSHAGRGRYLLSAGEGRNTREAESGVMRLIAHPQCLEVIKRYVDVVQADNVSQTraastplhISSYPGSSLLA 111 Xylella fastidiosa
Q9A998  32 SPALAVIDTHAGAGGYDLAGEMARRSGEAQAGIFRLKAAADAPAVFQPLLNAITQMNGGKD--------GDLYPGSPRLM 103 Caulobacter vibrioides
6QDX_D 108 RQLLREQDSLQLTELHPSDYPLLRSEFQKDSRARVEKADGFQQLKAKLPPVS-----RRGLILIDPPYEMKT-DYQAVVS 181 Escherichia coli
P31777 106 AELLRSQDRALLTELHPSDYPILRNNFSDDKNVTVKCDNGFQQVKATLPPKE-----RRGLVLIDPPYELKD-DYDLVVK 179 Haemophilus influenza...
Q9KVF9 105 RAHLREQDRMVLTELHPSDYPLLEQEFHRDRQVSIYKEDGFARLKASLPPQE-----RRGLVLIDPPYELAK-EYRDVVR 178 Vibrio cholerae
Q9HUF0 104 RRLTRAQDRVLLNELHPEDGRLLKANMAGERRVAVHQGDGWLLPRAFLPAPE-----KRAVLLIDPPFEQAD-ELQRCVA 177 Pseudomonas aeruginosa
Q9PHA1 112 AQVCRAQDRMVFCELHPKEAAALNALFVHDPRVRVHAGDGYAAVRAFLPPKVgtqriGRGLVFIDPPYEAQDaEYPLILG 191 Xylella fastidiosa
Q9A998 104 ARALRGADRYVGCELRDDDADLLRKTLAPCANARALQADGFDTAVKDAGKGG------RAFIVIDPPFERPD-DYDRIVA 176 Caulobacter vibrioides
6QDX_D 182 GIAEGYKRFATGTYALWYPVVLRQQIKRMIHDLEATGIRKILQIELAVLPDSDRRGMTASGMIVINPPWKLEQQMNNVLP 261 Escherichia coli
P31777 180 AIEEGYKRFATGTYAIWYPVVLRQQTKRIFKGLEATGIRKILKIELAVRPDSDQRGMTASGMVVINPPWTLETQMKEILP 259 Haemophilus influenza...
Q9KVF9 179 AIAQSYKRWATGIYAIWYPVVNRCDIDDMLEGLQGLEIRKILQIELGVAPDTNERGMTASGMIVINPPWTLESQMQTILP 258 Vibrio cholerae
Q9HUF0 178 ALDEAIGRMRQTVVVIWYPIKDQRQLKRFYQALERSVAPKLLRAELHVHPIDDAERFNGSGLAIVNPPWPLEDELRDLLP 257 Pseudomonas aeruginosa
Q9PHA1 192 ALRETLTRWPQAVCAVWYPIKQRRRLQPFFRKAGGLPVRSVLIAELLVRPDDSPLRLNGSGMLLLNAPWQFDQLLAPALP 271 Xylella fastidiosa
Q9A998 177 TTRAVLARAPDAALAIWLPIKDLETFDAFLRAME-TVTSDLLVAELRLRPLTDPMKMNGCAMVMIGAPPSVEDAAVAAGD 255 Caulobacter vibrioides
6QDX_D 262 WLHSKLVPAgTGHATVSWI-V 281 Escherichia coli
P31777 260 YLTKTLVPEgTGSWTVEWI-T 279 Haemophilus influenzae Rd KW20
Q9KVF9 259 FLKQAIAPA-TGHYKVEWV-V 277 Vibrio cholerae
Q9HUF0 258 WLAEVMAQS-QGGWRLDWL-V 276 Pseudomonas aeruginosa
Q9PHA1 272 VLKTQLGES-GARIRLEWLkV 291 Xylella fastidiosa
Q9A998 256 WIATRLGEP--GGRSRVWR-T 273 Caulobacter vibrioides
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap