Conserved Protein Domain Family
HemX

?
pfam04375: HemX 
HemX, putative uroporphyrinogen-III C-methyltransferase
This is a family of bacterial putative uroporphyrinogen-III C-methyltransferase proteins. It forms one of the members of a complex of proteins involved in the biogenesis of the inner membrane in E.coli. Uroporphorphyrin-III C-methyltransferase (HemX) is a single spanning inner membrane protein that regulates the activity of NAD(P)H:glutamyl-tRNA reductase (HemA) in the tetrapyrrole biosynthesis pathway.
Statistics
?
PSSM-Id: 398188
Aligned: 20 rows
Threshold Bit Score: 214.096
Threshold Setting Gi: 81358363
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011979007        172 QPSEWLLSEADFLLTNALRKLMLDNDVETGIALLKISDEVLAKVSEPEAKTVRAAINADLKQLLSVDSIDQNAVMQRLSQ 251 Actinoba...
WP_015939563        188 DQSEWLLSDADFLLNNALRKVVLDNDIDTARSLLIEADNVLSQVGDNRVLNIREAIKQDLSQLASVNNVDQNNLMQRLTQ 267 Glaesser...
USMARC:WQG_8430     190 EPTAWLFSDADFLLNNALRKMALDNDIDTARSLLIEADNVLSQVSDPKALAIRNAIKTDLNTLDSVNEIDQNTLMQRLAR 269 Biberste...
WP_012341016        179 QSTDWLLFETDYLLNNALRKIVLDNDVETAIALLKVADETLVKVNDPKVINIRQAINADLKQLLSVNNVDQNAIMQHLSQ 258 Histophi...
Q9CK22              205 QPNDWLLSEADFLLNNALRKLVLDNDVDTGVSLLKIADETLEKMSDPRVSMVRTAINNDLKQLLAVNNVDQNVIMQRLSQ 284 Pasteure...
Q6LLM7              188 RPNDWLLAEADYLIKMAGRKLWLEHDVISSTTLLESADHRIAELNDPSLRNVRKAMSNDITSLKAVARIDRDGLVLRLTS 267 Photobac...
JLExeter:vfu_A00431 164 RPNDWLLAEADYLVKLAGRKLFLEHDVDSATLLMESADQRIAALNDPSLTPLRKAMANDITTLKAIPRLDRDGLVLRLTS 243 Vibrio f...
Q5P7H8              132 TRDDRIVAETEQAIGIAAQQLQLAGNPEAALIALQGAEARLAAQDRGQFQALRRALVRDIERLQTAPQVDVPGIALRLEM 211 Aromatol...
WP_015488756        122 ERQDWLLAEAEYLLRLANQRLQLERDWDGALSMLSAADNVLLETRNPRMDKVRALIAREILALRAVPAIDRVGAILRIQA 201 Thalasso...
Q9HTT7              129 SRQQWRLAEAEHLLRLASLRLSALQDVGSATELVQGADDILRAQNDPGAYAARAKLAASLEALRALPEPDRTGLFVQLAA 208 Pseudomo...
WP_011979007        252 LANSVDELVVMNLNFGDHDVQTQDEQVSD--------NVTDWKNNLQKTATSFLNHFIRISPRTd-KVTQALLAPNQDIY 322 Actinoba...
WP_015939563        268 LANLLDDMPMIDNTVEE--ESVATGEVSN--------SVQDWQQNLEKSANSFLNHFIRISDKAt-AKEKAFVAPNQEIY 336 Glaesser...
USMARC:WQG_8430     270 LANLVDNLPMADSGESE---KADNGEVSD--------SIDDWQKNIEKSADSFLSHFIRINDKGrvVNDKAFIAPNQEIY 338 Biberste...
WP_012341016        259 LANGIDELVVLNVNFDE----QENTQLSD--------SLQDWKENVEKSAVSFLNHFIRVKPRH--VNSKELLAPNQDIY 324 Histophi...
Q9CK22              285 LANTIDELTVLDVNFDA---VNNNEKLTD--------SLDDWKENAEKSATSFLNHFIRITPRN--TSDKVLLAPNQDIY 351 Pasteure...
Q6LLM7              268 LQEQVATLPLANAIIPEAEAVEENA-VST--------SVDDWQINLKTSLKNFSEHFVTYRQRD--GSVIPLLSPKQDFY 336 Photobac...
JLExeter:vfu_A00431 244 LQQQVDTLPLANAILPDAPQETEQA-VSE--------NINNWQQNLMTSLKDFANNFITFRTRD--GNVVPLLSPQQHFY 312 Vibrio f...
Q5P7H8              212 LLERVDTLPLAFAGQLDDPAAARNAGASApegastepSVIDFITGLARDIWREMLTLVRIERLD--QSEPVLLAPAQSTY 289 Aromatol...
WP_015488756        202 LQEQVTSLPWMPEKLIAEPQTQDVAPIPL--------EEQTWYWNAWRYVKDNVTRMVRIRERT--APIAAPLTPDQQYY 271 Thalasso...
Q9HTT7              209 LREQVNQLQPLTPTFKEGESGASNVAWGD--------GNSTWELWWEK-----ISRYIRIDFNAg-QDIRPLLAGEQLAQ 274 Pseudomo...
WP_011979007        323 LRENIRLRLQIAILAVPRQQNELYKQSLETVAAWVRSYFDTDTELAKNFLKSVDELAEQSIYVDVPNQLNSLNALDKLLN 402 Actinoba...
WP_015939563        337 LRENIRLRLQIAILAIPRQQNELYKQSLEAVSTWVRSYFDVQNEQVKTFLKEIDEMIEQSIYIDAPNRLHSLGLLDQLLN 416 Glaesser...
USMARC:WQG_8430     339 LRENIRLRLQIAILAVPRQQNELYKQSLEAVSTWVRSYFDLQNADVQTFLKELDSVGEQSIYVDAPHKLQSLELLERNLN 418 Biberste...
WP_012341016        325 LRENIRLRLQIAIMAVPRQQNDLYKQSLEIVGSWIRSYFDTSTEVAQNFLKEIDELAEKSIYVDVPNQLKSLLLLDKLLN 404 Histophi...
Q9CK22              352 LRENIRLRLQIAIMAVPRQQDELYKQSLETVASWIRSYFDTNSEVAQNFLKTLDELAEQSIYVDVPSQLQSLNALDKLLD 431 Pasteure...
Q6LLM7              337 LQENIKSKLETAIHSVYREQGKVYATSLTMAKQWAEQFYNLDNPATQSFINTLDQLAKENIEASYPDRLQSQPIISDLIN 416 Photobac...
JLExeter:vfu_A00431 313 LKENLKAKLETAIKSVYTEQQEIYTVSLTTADQWSKSFFNQSDNRVKAFNQTLEQLAKQQVQVEYPVKLGTQKQLADVIT 392 Vibrio f...
Q5P7H8              290 LRENLKIRLLTARLALLARDGRTFAADLAQAQGWIERFFDQRDPAVQETLAELAALQALPVKVEQPTPTESLGALRMLQA 369 Aromatol...
WP_015488756        272 LQQNMRLMLEQAQVALLREQTDLYQHSLKRVHQWLDEYLMMSDERTRAAYAALTELQAWNAAPARPDISASLLELQTLVE 351 Thalasso...
Q9HTT7              275 VRLTIGLALEQAQWAALNGKQEVYEQALKQAQDVLDGYFNVELADSRALKLRIDELAKQPVTVQVPDLAPALSALQAYVS 354 Pseudomo...
WP_011979007        403 KKPQEI 408 Actinobacillus succinogenes
WP_015939563        417 KAPKPI 422 Glaesserella parasuis
USMARC:WQG_8430     419 KASKPI 424 Bibersteinia trehalosi USDA-ARS-USMARC-192
WP_012341016        405 KEQSSV 410 Histophilus somni
Q9CK22              432 RPSQDV 437 Pasteurella multocida
Q6LLM7              417 ERLRGK 422 Photobacterium profundum
JLExeter:vfu_A00431 393 DRLRRS 398 Vibrio furnissii NCTC 11218
Q5P7H8              370 RSAESR 375 Aromatoleum aromaticum EbN1
WP_015488756        352 QQRRGT 357 Thalassolituus oleivorans
Q9HTT7              355 RREAAG 360 Pseudomonas aeruginosa
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap