Conserved Protein Domain Family
DUF507

?
pfam04368: DUF507 
Protein of unknown function (DUF507)
Bacterial protein of unknown function.
Statistics
?
PSSM-Id: 398186
Aligned: 24 rows
Threshold Bit Score: 137.746
Threshold Setting Gi: 161162613
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAF70730            1 MRLRVAHAPYVANKIAIDL-VKSGFVTFTS-GVEPVVRVAQEILEEELKKEAALDERVRELIEAKEEEedPDLMLADRKQ 78  Nitratirup...
jgi:Arnit_0239      1 MKMKLHHTPYIARRISRDL-VNCEFVEVRK-TKEEITREVERILDIDIEKEHDLDEKVDEILAEQAEE--IEFLNADYRQ 76  Arcobacter...
WP_015902296        1 MLIKEAQVPFLARKISVDL-LNSGYVTFPK-NMDVATKEIEEIIEDDVAWEREIENKAREILAQQEEEneFLFYDVDRRE 78  Nautilia p...
Q025I2              1 MLLAREFVTYISKQLVKSL--TPGTIETSS--PDLLVERIAEVISEELAVEDRLNDEVRDLLSQYSEY--MRREGVSYQE 74  Candidatus...
Q08NL6              1 MRLYPKVIPIISRECIQTL-MQDGDIEVEPmRVADAEMDLSAIMREYLANEERVNQATREALERRGYD----------YS 69  Stigmatell...
WP_012828628        1 MKLYAGKIDTIAAEIIGQL-SRDGDIEVTE--SAEAQLDVVSVLKEYLRVDRELTERTKDVLEIRGLS----------HS 67  Haliangium...
CAN93918            1 MRLFSGKITPLTEELVRAL-VDNRDIECES--KKEVALDVESVFTSYLHAEREATERAKEILQARGLP----------QG 67  Sorangium ...
WP_012675941        1 MKIPARLVERIVENIIKEL-SDKHYVEAED--NEKFKKDLLEIINKAIAEEKEIEEQAEKLVEQHMHL--IESEDIRYRT 75  Persephone...
jgi:HY04AAS1_1086   1 MRLPERLVERIINKLVSEL-LTKKYIEVED--VDYFKKQLLAIFKEADEEEKNLDERAKEILKDQLSY--IEKENIDYRT 75  Hydrogenob...
O67633              1 MRLPERLVEAIAESIIQKLgKEEGILELED--PATFKKKIISLFKEADREEKELEEKAKAVLRENLEV--LERENIDYRT 76  Aquifex ae...
BAF70730           79 LFWMIKKKLAPEYGVIL----N-------YEDKYNDIAHQILKKLYEEDLIN-YSVPDNKVKNVIYDAITSYIK-TYDEI 145 Nitratirup...
jgi:Arnit_0239     77 LFWMTKKRLANEFGVIL----N-------NDDRFSDISHQLLDFLWEEDYIH-YTVSDNKVKNVIFDSISQFLE-GFEKA 143 Arcobacter...
WP_015902296       79 VFKLIKSKVAEEEGFNL----K-------RDERIDDLAHFLVKELWDKELID-YDVRDGKIKNIIYKSIMEFLH-REIEA 145 Nautilia p...
Q025I2             75 MFRRIKNTLISQRKVIRasgrDtgdpmklSRDKVGEISHKVVEMLRKNRDLRlKNKDSNAIRLEIVRLMTELLL-AEDKV 153 Candidatus...
Q08NL6             70 KFNQVKREMADVRGFKM------------GDEGIEYVINQMIEFLLISRNVEeVFSADNVLRAKIFSVMKKHLD-VDDEI 136 Stigmatell...
WP_012828628       68 AFGRTKRSLAEKQGFGL------------GEEGLSWICTQLVETFMQSSHIEeVYAEDAALRRKIKDVLRKHMEsVDQEL 135 Haliangium...
CAN93918           68 EFNRVKRLAAEQKGIKT------------GEETMDYLLDQLLEMLMHSNNVEeVFVEDHDLRRRIRPILRKYLE-MDEAL 134 Sorangium ...
WP_012675941       76 AVLKVKEKLAEERNIHL----D-------PEERMNQVAHQIRKYIETDPTIE-IFEHPNKIRRKVFEILKQLVK-EEKEI 142 Persephone...
jgi:HY04AAS1_1086  76 AYRTIRMKLAEEMKIET----R-------PRERMNQITNKIRDLIKNDPNIE-IYEDIPMIRKVISSILIEAAK-EEEEI 142 Hydrogenob...
O67633             77 AFLAVKRKLAEEMNINV----D-------RRERLNQIINRIMDLIMKDESVE-IYEDPPVIRKKIREIVLGALK-IEEEI 143 Aquifex ae...
BAF70730          146 EDIVLEKIANYKRKLIPGSEEFELVFKKMFEDELKRRGM 184 Nitratiruptor sp. SB155-2
jgi:Arnit_0239    144 DDAVYEKIKNYKRKLIQGTDEYDIVYHRLYEEELIKRGL 182 Arcobacter nitrofigilis DSM 7299
WP_015902296      146 RDEVYRKIENYKRPLVPGSEEFELVFQRLYEQELRKRGL 184 Nautilia profundicola
Q025I2            154 DRAARAKIRSQKKEVPEGSEEWDLMLRKYYAEELKKLGI 192 Candidatus Solibacter usitatus Ellin6076
Q08NL6            137 DKEARSRLKH----LQEGTSAFDIEYNKTVEQIRRARGL 171 Stigmatella aurantiaca DW4/3-1
WP_012828628      136 DREVRQRLKN----LEEGTVAWEVEYGKVMGKMKQKYGL 170 Haliangium ochraceum
CAN93918          135 DTEVRGKLRH----VQEGSRTWEIEYQRVMGEIQRRKGL 169 Sorangium cellulosum So ce56
WP_012675941      143 DREVRQRIKSYSKKILEGTPEWRILYNRIYEDALKRRGL 181 Persephonella marina
jgi:HY04AAS1_1086 143 EKEVRMRIKNYSKRIVEGTSEWNILYKRIYQDTLKQRGL 181 Hydrogenobaculum sp. Y04AAS1
O67633            144 EKTVRQRIKKYSRDLLEGSPEWQILWKRIYEDELKKRGL 182 Aquifex aeolicus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap