Conserved Protein Domain Family
DUF502

?
pfam04367: DUF502 
Protein of unknown function (DUF502)
Predicted to be an integral membrane protein.
Statistics
?
PSSM-Id: 398185
Aligned: 292 rows
Threshold Bit Score: 50.1496
Threshold Setting Gi: 311221113
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_009513202    81 LIVAVLITLLGYFSRNLLGRVFVQLAERAILGIPGVSAVYNAARQIITTFSAQNRNLFSKVVVVEYPRRGSWTIGFVTNR 160 Opitutaceae b...
jgi:Aaci_1869   57 LIVLAALFVIGLLSRAYVSRIVLQWADRLFTHIPVVRTVYTTVKELIENLFr-RRTAFQTPVLVMwPDERAQVLGFITSE 135 Alicyclobacil...
jgi:Natoc_0161  66 asLIGFFLVIGFAAEHTPGKRVSERVHATIETIPGVSVLYESVRRASDILVNDETDQFKEVKLVEFPHDDAYMFGFLTAD 145 Natronococcus...
jgi:Halxa_1612  66 aslFGLFLLIGFVAEYTPGRYISQRVHQTMETIPGVSTVYESVRRASKILADDDTDQFKEVKLVEFPHEGAYMLGFLTAV 145 Halopiger xan...
ELY71127        66 aSVIGVFLLVGLVAEYTPGTYLSKRVHATMETIPGVSTVYESVRRASKLLVEDESDQFQDVKLVEFPHEGAYMLGFLTAE 145 Natrinema pel...
jgi:Htur_0315   70 VSLFAFFLLVGIVAEYTPGKAISQRVHATMETIPGVSTIYESVRRASKLLVDDDTDQFQDVKLVEFPHRDAYMLGFLTAQ 149 Haloterrigena...
ADD05760        70 asLVGFFLLVGIVAEYTPGRHISKRLHATMETIPGISTVYKSIRRASHMLLDDDTDQFEDVKLVEFPHEGAYMLAFLTAQ 149 Natrialba mag...
BFU:L593_13075  75 VILLGIVLAVGSVGHNRYGERVIEVLDMAIASIPGIGTVYKSFRRMGDVMLTTEDENFQDVKLVQCLDEDMYVIGFQTSA 154 Salinarchaeum...
ADE04440        91 LVLFAIVAVVGTVGRNQYGEKIIGVFDLVVSSIPGVGTVYKSFRRMGDVVLDEGADEFQDVKLVQCFDDDVYVLGFQTGG 170 Haloferax vol...
WP_008416804    71 LTLLVLIVAVGIVAEHTDGTRVEGGFHAAMESIPGVSSIYNSFRRMSDILLESDVESFQEVKLVEFPRDGSYTLAYLTGR 150 Halalkalicocc...
WP_009513202   161 T-QGEPQIRaggehdgeagQPLERWTVFVPTSPnPTS 196 Opitutaceae bacterium TAV5
jgi:Aaci_1869  136 TlPE-ALD-----------PQGRMVAVYLPNAFqFAg 160 Alicyclobacillus acidocaldarius subsp. acidocaldarius DS...
jgi:Natoc_0161 146 T-PVTIERTv---------DGDEMMTLMVPLGPnPTT 172 Natronococcus occultus SP4
jgi:Halxa_1612 146 T-PDDIEQSv---------ASEDMVTIMVPLGPnPTT 172 Halopiger xanaduensis SH-6
ELY71127       146 T-PPMVEASa---------GEDEMVTLMVPLAPnPAt 172 Natrinema pellirubrum DSM 15624
jgi:Htur_0315  150 T-PPEIETQv---------ENGPMVTIMVPLAPnPTT 176 Haloterrigena turkmenica DSM 5511
ADD05760       150 T-PPVIEAQa---------DEGKMVTIMVPLGPnPTT 176 Natrialba magadii ATCC 43099
BFU:L593_13075 155 A-PEAVEDAt---------DHEDMMTLFVPMAPnHVT 181 Salinarchaeum sp. Harcht-Bsk1
ADE04440       171 S-PATIEQSt---------GHKEMVSMFLPLAPnPVT 197 Haloferax volcanii DS2
WP_008416804   151 P-PAELVAAt---------GHEEMLTLFVPFAPnPVM 177 Halalkalicoccus jeotgali
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap