Conserved Protein Domain Family
Serglycin

?
pfam04360: Serglycin 
Serglycin
Serglycin is the most prevalent proteoglycan produced in haemopoietic cells. Serglycin is a proteinase resistant secretory granule proteoglycan.
Statistics
?
PSSM-Id: 398178
Aligned: 15 rows
Threshold Bit Score: 156.075
Threshold Setting Gi: 281351644
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_013012440   2 QALPTCGRLGLALVLILALGSSVQGYPMRKARYQWVHCSPDSNSANCIEEKGPVFDLPTDDYNEILPSKTDPFLIRKRQN 81  domestic guinea...
ELK09583       2 QVLLQCRRLVLALILILVLDSSVQGSPVRRARYQWVRCNPDSNSINCVDEKGPEFDLPPGESNRILSPRTDPFSMTIPQN 81  black flying fox
XP_003994047   2 QRLLQGTTFVLALALLLVFDSSVQGSPVRRARYQWVRCNPESNSANCIDEKGPMFNLLPDETNRILPPRTDPLLMTGSQN 81  domestic cat
XP_006148994   3 QKLLKCTRMVLALFLILALESSVQGYPMRRARYQWVRCSPDSNSANCIDEKGPLFDLLPEESNRILPPRSDPFSMTKFRN 82  Chinese tree shrew
XP_003783655   3 qWLLKCRGLVLAFALILVLGSSVQGYPMRRARYQWVRCNPNSNSANCIDEKGPMFDLVPDESNRILPPRTDPFSMTRLQN 82  small-eared galago
P10124         3 QKLLKCSRLVLALALILVLESSVQGYPTRRARYQWVRCNPDSNSANCLEEKGPMFELLPGESNKIPRLRTDLFPKTRIQD 82  human
XP_008268250   2 QKLLTCSGLVLALGLILTLDSSVQGYPMRRARYQWVRCRPDSNSANCIDEKGPVFNLLPGDSNRILPLRTDPFFRTGPQR 81  rabbit
XP_004846234   2 QAVLTCGRLVLALTLILVLGSAVEGYPMRKARYQWVRCNPHSNSANCIEEKGPLFDLPTDESNRILPPKADPYLMPKFPN 81  naked mole-rat
P13609         2 Q-VPVGSRLVLALAFVLVWGSSVQGYPARRARYQWVRCKPNGFFANCIEEKGPQFDLI-DESNNIGPPMNNPVLMEGPSK 79  house mouse
1_pfamImport   1 --VSHSQRLLVTRSFLLGWDNSTKSHPMRKARHQWVRCNPDSNSANCINERGPVFDLSPGESNRILPPRNDPFSSEFCSS 78 
XP_013012440  82 LNDIFPLSEDYpgsgsgsgssseSESGS--GSGFGSSSEKDYPAERQWDYQPLDEKDAFYYNLRPLRKNLPLDNQALGQD 159 domestic guinea...
ELK09583      82 LNDVFPLSEDY----------------S--GSGSGSDSGSGFSTETEQEYQPADKDDAFYYNFRP----LPSDDQDLGRD 139 black flying fox
XP_003994047  82 LNDVFPLSEDYfgsg----sgsgSGSGS--GSGSGSGSGSGLLTEIDQEYQPVDENDAFYYNFRPLKRNLPSDNQDLGQD 155 domestic cat
XP_006148994  83 LNDVYPLSEEYs----------gSGSGS--GSGSGSGSGSGFLTEMEEEYQPVDVNGPLDYFSRPLKTNLPSDFQDLGQD 150 Chinese tree shrew
XP_003783655  83 WNDIFPLSEDD------------SGSGS--GSGSGSGSGSGFLTEMEQEYQPVDESDAFYYNSRSLDRNLPSDNQDLGED 148 small-eared galago
P10124        83 LNRIFPLSEDYs----------gSGFGS--GSGSGSGSGSGFLTEMEQDYQLVDESDAFHDNLRSLDRNLPSDSQDLGQH 150 human
XP_008268250  82 LNDAFPLSEDVs----------gSGSGSdlGSGSGSGSGSSLPTEVEWEYQPVQEDGVFYHNSEPLERNLPSASQDLGHG 151 rabbit
XP_004846234  82 LNDVFPLSEDYsgs------gsgSGSGS--GSGSGSGSGKEYSTEMERDYQPIDENDVFYYNFRSLKKNLPSDNQALGQD 153 naked mole-rat
P13609        80 --DFISNYDDYgsg-------sgSGSGS--GSGSGSGSGSGFLGDMEWEYQPTDESNIVYFNYKPFDRILTEQNQDQPED 148 house mouse
1_pfamImport  79 -TDYLPFVSNFtdf-------sgSGSGS--GSGSGLSSESIFPNEINQEYQPVDGNNAFYHNFRPRGRDLPSDKQDSAQD 148
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap