1YX3,1SAU,1JI8


Conserved Protein Domain Family
DsrC

?
pfam04358: DsrC 
DsrC like protein
Family member DsvC has been observed to co-purify with Desulfovibrio vulgaris dissimilatory sulfite reductase, and many members of this family are annotated as the third (gamma) subunit of dissimilatory sulphite reductase. However, this protein appears to be only loosely associated to the sulfite reductase, which suggests that DsrC may not be an integral part of the dissimilatory sulphite reductase. Members of this family are found in organisms such as E. coli and H. influenzae which do not contain dissimilatory sulphite reductases but can synthesize assimilatory sirohaem sulphite and nitrite reductases. It is speculated that DsrC may be involved in the assembly, folding or stabilisation of sirohaem proteins. The strictly conserved cysteine in the C-terminus suggests that DsrC may have a catalytic function in the metabolism of sulphur compounds.
Statistics
?
PSSM-Id: 398176
Aligned: 150 rows
Threshold Bit Score: 99.4928
Threshold Setting Gi: 504245338
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1YX3_A        26 EVDGKQFAVDEEGYLSNLNDWVPGVADVMAKQDNLELTEEHWDIINFLREYYEEYQIAPAVRVLTKAVGKKLGKEKGNSK 105
Q6FB39         1 ----mQLQLDQDGHLLDYTIWNEEVAKKLAQSLDLELTEWHFQILQAVRQFYQQFGHSPATRPLIKFLMKTVSP-DINNA 75  Acinetobacter b...
WP_003660019   1 --mnhlpSLDDDGHLKNHTDWTPKIAQRLADTIGVTLESEHYQIIGEVRVFFETYHHSPSTRPLIKYLMASLPNLDISNQ 78  Moraxella catar...
Q1QW84        11 IVEGREIALDPEGFLVDLSVWTPAVADALAAEEGRTLTAEHWEVLDVLRDFYARYENAPAMRPLVKAVGQALGPEKGRSL 90  Chromohalobacte...
WP_013332379  12 vsdTTSVALDPEGYLVELEQWTPDVARALAAEEGIALDEAHWEVIEVLRDFYARYEMAPAMRPLVKAVGRALGPEKGRSI 91  Halomonas elongata
CCU72203       1 ----mtFSTDNDGFLLNLADWNADVAQSIASNEGIELSNAHWEVLHALREFHAKYDLSPAMRPLTRHLKESLGPEKSTSI 76  Thalassolituus ...
WP_003240638   5 NVAGREIALDKDGYLADLQDWSHPVAEALAAAEELQLSDEHWEILDLLRAFYDEFQLSPANRPLIKYVALKLGPDKGNSL 84  Pseudomonas
Q87ZT3         5 MIDGRSIELDKDGFLKHLDDWSMDIAHALATEEGIALSAEHTEILLLLRDFYAEFQLSPATRPLIKYTALKLGTEKGNSL 84  Pseudomonas syr...
Q88FT6         5 TVGDQVIALDKDGFLVDLQDWSHDAAEALAKREGIPLTADHWEILELLRQFYQEYQLSPATRPLIKYTALKLGPEKGNSP 84  Pseudomonas put...
Q2SJ28         1 -mtlQDLPLDKDGFLVNLNDWSPTIAEEIAAHENIALTPEHWEIIDVVRDFYDEFGLSPVNRVLVKTTGAKLGQDKGNSI 79  Hahella chejuen...
1YX3_A       106 YLYSLFPYGP-AKQACRFAGLPKP 128
Q6FB39        76 ILQQRFNTGLvARHLSRLAGVPKP 99  Acinetobacter baylyi
WP_003660019  79 KLQKLFNTGLvARHVNRIAGLPKP 102 Moraxella catarrhalis
Q1QW84        91 HLMRLFPDSP-AKVGARLAGLPKP 113 Chromohalobacter salexigens DSM 3043
WP_013332379  92 HLMRLFPGSP-AKVAARLAGLPKP 114 Halomonas elongata
CCU72203      77 YLLKLFPGSP-AKIAAKIAGLPRP 99  Thalassolituus oleivorans MIL-1
WP_003240638  85 HLNRLFKGTP-AKLAAKLAGLPKP 107 Pseudomonas
Q87ZT3        85 HLNRLFNGTP-AKLAAKLAGLPKP 107 Pseudomonas syringae pv. tomato
Q88FT6        85 HLNRLFNGTP-AKLAAKLAGLPKP 107 Pseudomonas putida KT2440
Q2SJ28        80 YLMKLFPGGP-AKIACKIAGLPKP 102 Hahella chejuensis KCTC 2396
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap