1QZ4


Conserved Protein Domain Family
DUF489

?
pfam04356: DUF489 
Click on image for an interactive view with Cn3D
Protein of unknown function (DUF489)
Protein of unknown function, cotranscribed with purB in Escherichia coli, but with function unrelated to purine biosynthesis.
Statistics
?
PSSM-Id: 398174
Aligned: 89 rows
Threshold Bit Score: 204.639
Threshold Setting Gi: 81393386
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1QZ4_A           7 DITLALAGICQSARLVQQLAHQGHCDADALHVSLNSIIDMNPSSTLAVFGGsEANLRVGLETLLGVLNASSRq-GLNA-- 83  Escherichia coli
A1AX18           6 NQTLALASILQTTTLVDQLASTGACDANSNQASLKSII-TSSTKLEEVFNS-KQDLLVGIAALKVVLGNKTKriQ----- 78  Candidatus Ru...
CBL47026        12 hKAMALAGIFQATALVQQLARTGELSRTDLDCLMGSIFVMDPQDVSEVYGG-VKPLSHGIDILLEILDKNQT--QRYG-- 86  gamma proteob...
jgi:Fraau_1183  10 ERVLALAGLFQATTLTQQLAQTGQCDHNALESSMASIFAIDAPSVPAVYQG-VAGVRVGLRNLVDQLDSQPR----QL-- 82  Frateuria aur...
WP_013535206     7 DRVLALAGLAQSLQQVRRIAETGHSDTGAAQPVLDSVFRIDAPSAAAVYGG-VPALAPGLRLLDAYLSSRAD----DP-- 79  Pseudoxanthom...
DSC:DSC_09460    7 ERVLALAALAQALAQVRRIAETGQSDNSAAGTVLDSVFRMDAATTEAVYGR-AANLGPGLRLVRDYFGGENK----DP-- 79  Pseudoxanthom...
WP_012915952     7 tRMLALAGMAQALQQVRRIAETGHSEASLVRTLLDSVFRIDAPSAEAVYGH-RSDLVPGMRLLHQYFRNQGQ----DE-- 79  Xanthomonas a...
Q9PDE0           7 NRVLALAGVVQALQQVRQIAETGQSETSAVRTAINSVLRIDAESPEAVYGR-IRDLTQGLQLLHDYFGNQLR----DQ-- 79  Xylella fasti...
Q8P9A2           7 hRVLALAGVAQALQQVRRIAETGHSEAATVRTAVDSVFRVDAATPEGVYGS-SADVAPGLRLLHNYFTNQGK----DD-- 79  Xanthomonas c...
CAS:Atc_1694    12 DRTLALAGILRAAQEVQDAARRGIHDNSMLGSCVQSILSLDGRDSAAVLGG-LPSLRRALQGLCPLLQRGPG----SAee 86  Acidithiobaci...
1QZ4_A          84 -ELTRYTLSLMVLERKLSSAKGALDTLGNRINGLQRQLEHF-DLQSETLMSAMAAIYVDVISPLGPRIQVTGSPAVLQSP 161 Escherichia coli
A1AX18          79 -QVILYALALINLEKKLMKNQTLLNQITLEIDLIKNQEF-F-EISHANSVARLAQLYKSTLGGLNPRIMINGEQIYLSNK 155 Candidatus Ru...
CBL47026        87 -ESIRYAVGLLNIERQLRRKSDLLALLRSRLEQLDQQRVHFdSISHSSVIARLAQLYVDTMGTLRFRIQVKGDPRHLTQE 165 gamma proteob...
jgi:Fraau_1183  83 -NVVRMTVAVLRLERSLARRPAMMEHLQQGILTIQRQSGHF-ELGTSQLCNKLAQLYTETLSTLRPRVMITGDPHTLQRP 160 Frateuria aur...
WP_013535206    80 -LLPRLGLATVQLERRFSSEPATLQAVATGLSAIAPRALELg-STHPEVLSALGTLYADTISHLRPRIMVQGNPHYLGQA 157 Pseudoxanthom...
DSC:DSC_09460   80 -SLPRLAMAVLQVERRFIRETDTVKAVSGGLEAIAPQASERg-STHPDVLMALGTLYADTISRLRPRVMVQGNPHYLAQP 157 Pseudoxanthom...
WP_012915952    80 -VLPRLAMAVIQLERRLVSDTETDAKISIGIARTALLLEQHgDSTHPEVIEALGQLYAGTISHLRPRVMVQGNPHYLGQA 158 Xanthomonas a...
Q9PDE0          80 -LLPRLALAVLQLERRFIRDTSIVAAVSAGITQAAHQVEQTgDSAHPEVLSTLGALYANTISHLRPRIIVQGNPHYLGQA 158 Xylella fasti...
Q8P9A2          80 -MLPRLALAVLQLERRFVRDHSTVETVSKGIEAAARQAQTLgDSAHPDVLSALGALYAQTISHLRPKVMVQGNPHYLGQA 158 Xanthomonas c...
CAS:Atc_1694    87 aEQMRYALSLAKLGKALIHNHAATERVRRGIDEARRQIEHFgDAIHPSVLGGLANTYAEGIGILSPRIIVSGESRFLTQE 166 Acidithiobaci...
1QZ4_A         162 QVQAKVRATLLAGIRAAVLWHQVGGGRLQLMFSRNRLT 199 Escherichia coli
A1AX18         156 HTTNHIRALLLAGIRAVSLWKSQGGKTWHLLFNKKKIL 193 Candidatus Ruthia magnifica str. Cm (Calyptogena magnif...
CBL47026       166 ETANKVRAVFLAGVRSAILWRQLGGSRTDFFLRKRALV 203 gamma proteobacterium HdN1
jgi:Fraau_1183 161 EVVAKVRTGLLAAVRSAMLWRQLGGQQWQLIAYRRHac 198 Frateuria aurantia DSM 6220
WP_013535206   158 GVVSEIRALLLAAVRSAMLWRQLGGSQWHFLLARKAMA 195 Pseudoxanthomonas suwonensis
DSC:DSC_09460  158 GVVSEIRAILLAAVRAAVLWRQLGGSLWDFVFSRKAMV 195 Pseudoxanthomonas spadix BD-a59
WP_012915952   159 GVVAEIRALLLAAVRSAVLWRQLGGSLWDFLLAKRRMR 196 Xanthomonas albilineans
Q9PDE0         159 GVVAEIRAMLLAALRSAVLWRQLNGNLLDFMLAKRAMA 196 Xylella fastidiosa 9a5c
Q8P9A2         159 GVVAEIRALLLAAVRSAVLWRQMGGSLWDFLFAKRAMI 196 Xanthomonas campestris pv. campestris str. ATCC 33913
CAS:Atc_1694   167 EDTVRIRALLLAGVRAAVLWRQAGGSVFTTFWERSALC 204 Acidithiobacillus caldus SM-1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap