1TXK


Conserved Protein Domain Family
MdoG

?
pfam04349: MdoG 
Click on image for an interactive view with Cn3D
Periplasmic glucan biosynthesis protein, MdoG
This family represents MdoG, a protein that is necessary for the synthesis of periplasmic glucans. The function of MdoG remains unknown. It has been suggested that it may catalyze the addition of branches to a linear glucan backbone.
Statistics
?
PSSM-Id: 398168
Aligned: 154 rows
Threshold Bit Score: 515.135
Threshold Setting Gi: 170656822
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1TXK_A              2 FsiDDVAKQAQSLAGKGYETPKS-NLPSVFRDXKYADY-QQIQFNHDKAYWNNlktPFKLEFYH-QGXYFDTPVKINEVT 78  Escherichi...
Q0BZM1             79 FdfEDVRRKAEILASRPFQTPP--GIPKEAGALNYDAY-RRIQLHQDAALWKDtsdKFRILPDP-RGYLFNYAIRLNFVE 154 Hyphomonas...
jgi:Caul_3563      43 FsvELLRDRARRLAAAPYAKPPAgPT---MTGLSYDDY-FQIRFRKDADLWKDrrpPFRAEFFP-PAYLYPRPLPIYEVA 117 Caulobacte...
jgi:Rvan_3033      39 FseELLDAFARRRADEPFKAPEK-KVDEALANLTYEQHnRAIVYKDDQAIWRNdnvPFRLEPYHtAGAIFAFPVELFQVD 117 Rhodomicro...
jgi:Rvan_3034      37 FsfATLVERARQLSLSPYAPPAD-TIPANYKDLNYDQY-RDIRFKREEALWANdnlGFTAEFFS-AGYLYTTPVQIFTVA 113 Rhodomicro...
WP_014890186       43 FsrDMVVELARALAAKPYTPPRT-DLPEPFANLSYEQF-VGIKTKPDSAIWRHdntGFSIEPLH-RGHIFAAAVDIYVVE 119 Methylocys...
WP_012384789       65 fepANVTEAARALARQAYKPLRQ-PLPDVFAALSHDQY-GTIYAKPGTALWAGdnlGFAIEPLH-RGFIFSDPMEINIVE 141 Beijerinck...
WP_012589751       60 fnpAMVTELARSLAKQPYKALAA-DLPDAFKGLSYDQY-VAIHLRPGGTIWAKdnvGFALEPLH-RGFAFSPPMQIHIVA 136 Methylocel...
jgi:Mrad2831_2986  50 FeaNTLTDLARARAAAPYAAPKTgDVPAVLKNLSREAY-EAIRPAEGRAVWADrnaGYVLEPLL-RGSIFETPVSLFVVE 127 Methylobac...
jgi:Mnod_1824      53 FdpGTVVALARALAAKAYAAPPN-DLPDAFGKLSYEQY-VAIRPKPELLVWRDegrGFVVEPLH-RGYLFTNPVALHTVE 129 Methylobac...
1TXK_A             79 ATAVKRIKYSPDYFTFGDVQHDKDTVKDLGFAGFKVLYPINSkdkNDEIVSXLGASYFRVIGAGQVYGLSARGLAIDTAL 158 Escherichi...
Q0BZM1            155 EGKEVSRPYSPEDFNFfdlPLSDEAKQLLGFAGFRVVTPLNIagkWDELISFRGASFFRALGAGNLYGASARGISIGTAS 234 Hyphomonas...
jgi:Caul_3563     118 AGLARPIAFDPAMFDIPGEh-ADAAKGWSGFSGFRLLWPLNEaekMDEIAVFQGASYFRSLGRGQRYGLSARGLAIGAGE 196 Caulobacte...
jgi:Rvan_3033     118 AGRATKIQYAADAFEFNAPAKAPATPAQSDFAGFHAQAQIDRlgvFRDFLRFLGATNFRAIASGQVFGVSARALAINTGQ 197 Rhodomicro...
jgi:Rvan_3034     114 NGRASELKYRADLFTYGQNVTPPPEGTAPGFSGFRIHTPIDkayqMDEFAVFQGASYFRAKATGQGYGLSARGLAIDTAQ 193 Rhodomicro...
WP_014890186      120 NAAAARLPYEASRFDYGAL-NVPETLHDLSFSGFRVLHAQNgg-aEAELAIFQGASFYRAVARGQNLGVTARGLSIRTAD 197 Methylocys...
WP_012384789      142 HGAARRLVYDQAQFAFGKL-AVPNAMGDIGFSGFRILVPQDaq-nFGALATFQGASFFHAIARGQSEGVTARALSIKTAD 219 Beijerinck...
WP_012589751      137 DGAARRVIYDAAQFDFGKP--APANLGDIGFSGFRVLAPLEhg-gFFELATFQGASFFRAVGHGQEPGTMARALSIKTAD 213 Methylocel...
jgi:Mrad2831_2986 128 NGLVQPVGYDKSAIAApg-ldLPDLAADTAFSGFRLRARFDGadgFSNFALFQGGSFFRLVAEGQDFGINARALALRPAD 206 Methylobac...
jgi:Mnod_1824     130 DGIVRRIAYDRSRFEFRKA-SPPEEGRDLGFSGFRLYASFGgg-pPTDCAIFQGASFFRALAAGQSYGVTARALTLRPAE 207 Methylobac...
1TXK_A            159 PSGEEFPRFKEFWIERP-----KPTDKRLTIYALLDSPRATGAYKFVVXPG-RDTVVDVQSKIYLRDKVGKLGVAPLTSX 232 Escherichi...
Q0BZM1            235 PEGEQFPYFREFWLQKP-----APGTDTIRIYALLDGESITGAYELSVTPG-VETKMQITAALFPRKELATVGISPLTSM 308 Hyphomonas...
jgi:Caul_3563     197 PN-EEFPDFTAFWLERPpieseAIDGDAVTVHGLMDSPSCAGAYSFTIRPG-EDVVFDVAAAVFPRTTLAKAGVAAMSSM 274 Caulobacte...
jgi:Rvan_3033     198 TGGEDFPLFRSFWIERP-----RPVDQSLVVHGLFDSVSAVGRYKFTVTPG-FDTIIDTEATIYPRRRIAYAGIAPIASR 271 Rhodomicro...
jgi:Rvan_3034     194 PPRDEFPVFRSFWIVRP-----ESGASSVTVFALLDSTSVSGAYKFVISAR-ANTVMDVDCTLFPRKTMAHVGIAPLTSM 267 Rhodomicro...
WP_014890186      198 PRGEEFPAFRSFWIEKP-----ALGDNALVIHALLDSPSVAGVYRFTLRPG-EATLIDTELTLYPRTAVDHLGIAGFAGA 271 Methylocys...
WP_012384789      220 PRGEEFPAIRAIWIETP-----TLAENALTLHALIDSESVAGAYRFTLHPS-EATIIDTECTLFARTNVDRFGLATMTGA 293 Beijerinck...
WP_012589751      214 PAGEEFPAIRTVWIERP-----TLAGNALTVYAIIDSESVTGAYRFTLRPG-DATIIDTECTLFARAALDNFGIATMSAT 287 Methylocel...
jgi:Mrad2831_2986 207 SRGEEFPLFRALFIETP-----RAG-QPVIVHALAESESATAAFRITLTPGrDVSTAQIDGTVFARTELDHIGLGGMQGS 280 Methylobac...
jgi:Mnod_1824     208 ARGEEFPMFRAFWLERP-----TPASGQIVMHALLDSESAAAALHMTLRPG-DATIVDIEATLFPRKTLDHVGIGGMTGA 281 Methylobac...
1TXK_A            233 FLFGPNQPSP-ANNYRPELHDSNGLSIHAGNGEWIWRPLNNPKHLAVSSFSXENPQGFGLLQRGRDFSRFEDLDDRYDLR 311 Escherichi...
Q0BZM1            309 YFFSPHDIRKfQNDFRPAVHDSEGLSIQMYNGEWVWRPLFNPKALQVSVLADRPPLGFGLVQRKRAFEDYSDIEAGYHHR 388 Hyphomonas...
jgi:Caul_3563     275 FLFNVADASP-VDDFRTAVHDSDGLAIWTGRGEHLWRPLRNPKVHRLSHFPDDSPKGFGLVQRARALEDFGDLQARYDLR 353 Caulobacte...
jgi:Rvan_3033     272 FFFGPSAAPK-RRDFRPRVHDSEALAILNGQGEQIWRPLLNPERLQFSVFVDKGPRGFGLIQKERSFAAYQDTDAQFEKR 350 Rhodomicro...
jgi:Rvan_3034     268 FYFAPSTSYR-ADEVRNRVHDSDGLAIWNGKGEHIWRPLINSPRVQFSSFVDDAVRGFGLVQRERRGDRYEDFEAHYEQR 346 Rhodomicro...
WP_014890186      272 SLFTPLDRPR-VDDWRPMVADINGIQMLSGQGEWLWRPVSNREILQFSSFVDDGPRGFGSLIRQRDIDDYEDDQQHWERR 350 Methylocys...
WP_012384789      294 HLLAPVDQRH-MDDLRPQVSEVGGLAMLSGRGEWLWRPVANRETLQISVFTDEKPHGFGFLQRDRAFDAFQDDFQHWETR 372 Beijerinck...
WP_012589751      288 HVAGAIDKTR-LDDLRPQIGEIDGLQILTGRGEWLWRPVSNPATLQISSFIDENPRGFGFLQRDRNFDHFQDDDQHWENR 366 Methylocel...
jgi:Mrad2831_2986 281 YLFGALDRNR-VDDLRAAAFSVEGLAIHNGYGEPIWRPVHNPEALQVSAFVDRGPKGFGLMQRARAYDDFEDDRRHWEQR 359 Methylobac...
jgi:Mnod_1824     282 FLFGPTDHRN-VDDARTAAHEVGGLQIRNGWGEAIWRPVQNPETLQISSFLDQDPKGFGLVQRDRDYAAFQDDVQRWERR 360 Methylobac...
1TXK_A            312 PSAWVTPKGe---------WGKGSVELVEIPTNDETNDNIVAYWTPDQLPEPGKEXNFKYTITFSRD-----EDklhaP- 376 Escherichi...
Q0BZM1            389 PTVWVQPKAg---------WGEGELTLVEIPTGNEYNDNIVAYWKPKTPWQPGTAYTVSYDMKWSLLts--sVPd----- 452 Hyphomonas...
jgi:Caul_3563     354 PSLWVEPLDa---------WGKGAVHLAELATTKETDDNIAVFWRPEQSWAAGSQVDLRYRLYWGQEr---------fAs 415 Caulobacte...
jgi:Rvan_3033     351 PSLWIEPVGd---------WGEGSIDLIELPAPEEVNENIVCFWRPKDGLGPGIGHRYRYRMHWCWT-----PPi---En 413 Rhodomicro...
jgi:Rvan_3034     347 PSLWVEPREs---------FGQGSVDLVELPTTTEYFDNIVAYWHPKEPLAAGVSYAYKYRLTWCDA-----PPl---Ri 409 Rhodomicro...
WP_014890186      351 PSLWVEPLGe---------WGEGALQLVEIPSESEINANIVAYWRPKTALVAGKEASFAYRQFWCWE-----PPt---Rp 413 Methylocys...
WP_012384789      373 PSLWIEPIGe---------WAAGALQLIEIPSDAEINDNILAFWQPRQALAPGSETSFAYRQFWCWT-----PPv---Sp 435 Beijerinck...
WP_012589751      367 PSLWIEPIGd---------WAAGAVQLIEIPSESEVNDNIIAYWRPKQPLNVGAEISFAYRQFWCRV-----PPe---Rp 429 Methylocel...
jgi:Mrad2831_2986 360 PSLWLEPLDd---------WNEGAVTLLEIPSDSELNENVFAYWRPKAKLAKGAEMRFQCRQHWSKGwpdplPPe----- 425 Methylobac...
jgi:Mnod_1824     361 PSLWVEPYNtwgpdreqrpWGAGAVQLIEIPSESEVNENILAYWRPKEPVT--TETAFSYRQFWCWD-----VPg---Ap 430 Methylobac...
1TXK_A            377 DNAWVQQTRRSTg--DV-KqsNliRqpdgtiAFVVDFTGAEXkkl-------peDT--P-VTAQTSIGDNgEIVEST--- 440 Escherichi...
Q0BZM1            453 -VATVKNTFAGVkpaa------------tqqLFVIDYeq-------------ipAAllEgVEAEITTSAG-KVLNPI--- 502 Hyphomonas...
jgi:Caul_3563     416 PDARVFRTRTGAdaqa------------glrLFTVDLQGGAL------------AEglDgVALEIQADGG-TIAWKD--- 467 Caulobacte...
jgi:Rvan_3033     414 RRASVAQTRIGEtks-------------gdiAFIVDFANTERcdg-------cnPS--A-VATQVTASAG-EVRNVR--- 466 Rhodomicro...
jgi:Rvan_3034     410 NYATVAQTLVGA---------S--LqnagrrLFNIDFAGTEEfnlcddsdefcgDK--S-RVMELTASAG-TIVNAT--- 471 Rhodomicro...
WP_014890186      414 PLAIAMNARSGRapgAKlR------------RFIVVFSGDVLadp------qrtTQ----LKAALTTSPG-LATNIR--- 467 Methylocys...
WP_012384789      436 PLAITTASRQGHgsaARrR------------RFLVQFTGPGLadp----------qkiKdVKPNLTATPG-TILDMR--- 489 Beijerinck...
WP_012589751      430 PLATVALSRSGRggsARrR------------RFLVEFSGGALsqi----------kdaSdIAAKLNVAPG-SFFLLR--- 483 Methylocel...
jgi:Mrad2831_2986 426 -IARVRDSRCGRgssGNrR------------LFAVDFEGDALfq-------------pGdIDVDLAASAG-TITRQE--- 475 Methylobac...
jgi:Mnod_1824     431 PLARCTGTRVGKgsgGKrR------------LFLVDFTGEALfap------gtaPE--A-LKLSVTASPG-AIVQPKpda 488 Methylobac...
1TXK_A            441 ------------VRYNPVTKGWRLVXRVKV-KDAkKTTEXRAALVNADQTLSETW 482 Escherichia coli
Q0BZM1            503 ------------IKTNPETGNVRLSFELEA-QNI-EVAELRALLTKGGKPITETW 543 Hyphomonas neptunium ATCC 15444
jgi:Caul_3563     468 ------------LSPYPDEASARAAFGLRPtQAS---VDLSLRLVRGDQPISETW 507 Caulobacter sp. K31
jgi:Rvan_3033     467 ------------VAAGPETGMQRLRFEYAP-SGS-DPADLRAQLLVDGKAVSETW 507 Rhodomicrobium vannielii ATCC 17100
jgi:Rvan_3034     472 ------------IRRNRVSGGHRVAFEYEPaAGS-DEADLRCALLSDGKPISEVW 513 Rhodomicrobium vannielii ATCC 17100
WP_014890186      468 ------------TYLNPSAKSCRVAFDVDP-AGE-NYCELRLVLQSDERPISETW 508 Methylocystis sp. SC2
WP_012384789      490 ------------TFALPERQSYRIVFELDP-GTE-TTSEMRLVLEVAGVPISETW 530 Beijerinckia indica
WP_012589751      484 ------------TLLSTESASFRVLFELDP-GNE-AYSELRLVLESQGKPISETW 524 Methylocella silvestris
jgi:Mrad2831_2986 476 ------------RFRYSDRKTLRILFELDP-GSE-RASELRLALRRGQARASETW 516 Methylobacterium radiotolerans JCM ...
jgi:Mnod_1824     489 ppvkrdpqfrplLYLYPERKTVRAVFELDP-GGE-TACEMRLVVKNGDQPVSETW 541 Methylobacterium nodulans ORS 2060
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap