Conserved Protein Domain Family
EutH

?
pfam04346: EutH 
Ethanolamine utilisation protein, EutH
EutH is a bacterial membrane protein whose molecular function is unknown. It has been suggested that it may act as an ethanolamine transporter, responsible for carrying ethanolamine from the periplasm to the cytoplasm.
Statistics
?
PSSM-Id: 398166
Aligned: 46 rows
Threshold Bit Score: 317.918
Threshold Setting Gi: 524642080
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9I3M1         4 FGNYVIYLIMLGAVLGALAS-ILRPESGLGREFVNGIHAIGPVFLAQAGIMVAIPYLSKAISHALGPFFQTLGSDVSIAA 82  Pseudomonas aer...
BAL01417       3 ayHIIQAIIAVCLSVGAMDS-LLGNKFHLGEEFDKGIRAAGTLLLCMSGYLAIAPVCAKLLTPIVTPLCHMTGLDPSVLA 81  Oscillibacter v...
WP_022132584   1 -mnfpIAVLLLCALIGLADK-MIGGRFGLAEEFDRGMTMMGSLAVTMSGVYCFSVMLGRLLSTVLQGV--SLPLDPTILV 76  Negativibacillu...
CDA61298       1 -mnlpIAILLLCAMLGLVDK-ILGNRMGLGEEFDRGLTMMGSLALTMSGIYCFSVMLGRWLAVWLQGV--SLPFDPTLLV 76  Clostridium sp....
CDD58272       1 -mNIFIAIMLVFAAAGLLDE-ILGGKLGLMPNFEKGLATMGGLAMSTVGFYAIGVTYVQTHAEAIAEAAKHMPFDPALIP 78  Clostridium sp....
WP_025435104   1 -mnVFIILMLLLACVGLFDK-ILGGRWDLSKEFDKGLALMGPMALSIVGLYCIGITAVQANATAIAELAEVLPFDSSVII 78  Peptoclostridiu...
Q8XI93         1 mEKLVLGIIGIFFVISGFDY-INNNKLGLGDKFKDGMISMGSIAISMVGIYSLSPLIGEGIGFLLTPISNFIGIDSSIFP 79  Clostridium per...
WP_010076946   1 mDKLILYIVGSFFIIGGIDY-ILGSPLKLGLKFEEGIKTMGPLGIGMVGIYSLAPLVSNFLITMIVPICKELNLDPSIFP 79  Clostridium cel...
CDE05356       4 FSTIVVGIMTAFALVGIIDQlFLKNRLGLGAEFQRGIEMIGPLCLAIVGIIALVPEMKWGIEHTLTPLYRTLGLDPSMAV 83  Anaerotruncus s...
Q4K5E5         4 IGNYVLYLIMLCAVLGAFAA-IYDSERGLGKEFMEGIHATGYIFVPAAGIMASIPYLTVVIETVFGPFFNSLGADPALAA 82  Pseudomonas pro...
Q9I3M1        83 lSIIAVDMGGYQLADALTANRD-MWITAMLVGYTSGATIVYLIPVGLTMLERKDHKYLALGAMAGLISIPFAVLAALLLi 161 Pseudomonas aer...
BAL01417      82 gLFFANDSGGASLAIQLAQDKQiGLYNAYIVSAEMGTTVMYTVGLSMSTITPAQKKYAAYGIACGIVTMPISCIAGAAV- 160 Oscillibacter v...
WP_022132584  77 sSVLATDMGAYSIADTLCTDYTqKIFSGVLLSATLGTTISFSLPIALGSIPSKDSKNLMTGMVYGIIAIPVVLIIGSLL- 155 Negativibacillu...
CDA61298      77 sSVLATDMGAYSIAQTICTSPAqLIFSGVILASTLGSTISFSLPIALGSVPAKDSKTLMTGMVYGIIATPAALLIGGLM- 155 Clostridium sp....
CDD58272      79 sCLLAPDMGALGMAQKLAATPAlAAFTGAMVAGSLGMTVGYQLPVFLAAVRKDEIGELMRGFIFGLIAIPSGLAVGGLM- 157 Clostridium sp....
WP_025435104  79 gSILATDLGGYAISKNIAATPLlGLFSGVIVASSLGCAVSFQLPVSLATIPKEEVGPMMNGLLLGIITIPAGLLAGGIM- 157 Peptoclostridiu...
Q8XI93        80 sMFLAVDMGALGIAESLSSNIHmYWISGVIIASTLGATISFSIPLALGIIEEKYLEDLTTGLLYGIMTLPIAPIVAGLF- 158 Clostridium per...
WP_010076946  80 aTFLAVDMGGYQMATKLALTEEmGTFSGIIIASTLGSTISFSIPVALGMLSKEDESYFSKGVIVGIITIPIGCFIAGMW- 158 Clostridium cel...
CDE05356      84 tSILAIDMGGYQLAESVAIDPLiGQWAGIVYGSMMGATIVFTIPVGLAAIGKQDVAAFSKGVLYGIAAIPIGTFVGGLV- 162 Anaerotruncus s...
Q4K5E5        83 tMIIASDMGGYQLASALAASKE-ALVMALITGFMGGATIVFSIPMGLAMLDKRDHKYMALGIMSGILTIPVGVMIASLIl 161 Pseudomonas pro...
Q9I3M1       162 tlNHipvrelvstgspalhylsLDFLDMLRLLAPLFVFCFLLAAGLKYRATAMVTGFLVFGKVMDAFIKMALALSIVQHF 241 Pseudomonas aer...
BAL01417     161 --AG------------------FQLDAVLFNTLPLIALSVLLCLLLLFAERVTVLIVVLLGKFMTALSVVALTIAACQEL 220 Oscillibacter v...
WP_022132584 156 --SG------------------MALTALLKSLLPVLLICALLGLCIFYGGEKAIRVFQRVGKGINLLAIFLFVLIVLQVF 215 Negativibacillu...
CDA61298     156 --AG------------------MTGKELLSSLLPVTLICVLIALSIFFGGERTVGVFQVMGRGINLLAIVLFALVLVQVF 215 Clostridium sp....
CDD58272     158 --LG------------------LPVRQLFFNMIPVLVLCMVLIAAFVLVPALTMKIMIFLGNAIRIFSFLLFGVAVFGIF 217 Clostridium sp....
WP_025435104 158 --LG------------------LTVSELAVNIAPVALLCLLLAMFFVKAAKATMMVMSFVGYAIRAASFAMFAVVIAGLF 217 Peptoclostridiu...
Q8XI93       159 --LG------------------VDIKLLLFNIFPLIIFAILLAVFMNRFKDTTVKFFIKLGKLIQLVSILGLLVLGFLSI 218 Clostridium per...
WP_010076946 159 --LK------------------IQLITLFWNLLPIYIFIILLVIGLIKTPGFLMKCFNIFGKLIMSFSIIGLLFQGIDSI 218 Clostridium cel...
CDE05356     163 --MG------------------IPVGTVALNLIPPVIFSVIIIVCLALWPGKTTAVFRVFSVIINIIAMLGLGLAMVKDL 222 Anaerotruncus s...
Q4K5E5       162 afSNpqvrelvstsgeasyqlaLGLGSIFANLLPILIFVVALALGLRFLPDMMIKGFIIFGRAMDAAIKLVLVFSIVEYF 241 Pseudomonas pro...
Q9I3M1       242 TGvftkVFGGWGFDPMfade--kelFRAIEIAGYIGIMLAGTFPICYLFQRYCKRPMAVLGRYLGLSQPGATAFVMVLAN 319 Pseudomonas aer...
BAL01417     221 TG----VKILSGLETL---------PDIYPIVGGIAIFLAGAYPLMAIVQCIFKNQLQKIGSSLCINEVSVKGLILCTLN 287 Oscillibacter v...
WP_022132584 216 LAsdrfTLV--DPSLI---------GEVLTIVFKISVIVCGSFILSNLILKYFMHQILSLARKIHVNEFAIIGLLLNLIN 284 Negativibacillu...
CDA61298     216 FDspsvQFV--DPALI---------GEVLTIVFKISVVVCGSFILSNLILRYFMHPILSLARLIHVNEFAIIGLLLNLIN 284 Clostridium sp....
CDD58272     218 MPkyavV----ENALI---------EEMLFMVLRMVIAACGGLVLSQVALKRLQKPIQRIGAVLGINEEAVVGLFLSFIQ 284 Clostridium sp....
WP_025435104 218 VPawriA----DMALV---------SEILVILAKMTAVVCGSMVLSRLAIMYCKRPIGWMSRKLDINEKSVMGLLLSLTT 284 Peptoclostridiu...
Q8XI93       219 LG----IKPIGSILSI---------DEALSVVGKIAIFLGGAYPLINFITEKFSKVLSKIGEKINIDEFSIAAFLGTLAS 285 Clostridium per...
WP_010076946 219 FG----VKVIYNMAPL---------SESITIVSKISFVLAGAYPMLALINHIFKDSFKRIGDRFGINSASISGLLGNLAS 285 Clostridium cel...
CDE05356     223 ILvpiaGNGAFDLDSVpffgslgstAEGIGVAGSVGLVLAGALPFVYCLNKWLKKPLGSLSRRFGLTDAGVTGFLLSSAN 302 Anaerotruncus s...
Q4K5E5       242 TGafsaVFGGWGFHPIiada--edqTRALETAGYIGIMLAGAFPMVYLLRKYLGKPLENLGGKIGLSAVGSAGMLATIAN 319 Pseudomonas pro...
Q9I3M1       320 IIATYHLFKYMNARDKVLCVALGVCAQATIGDHLAFTANFQP-TLILPILLGKLFGGLLAVFIAIRI 385 Pseudomonas aeruginosa
BAL01417     288 MLVSYPLLPEMDEKGVMLNLAFWGSASCIFGDHLAFTSQQAP-ALVLPVLISKLIGGVLACLLALGl 353 Oscillibacter valericigenes ...
WP_022132584 285 SVSMLSVFGKMDKRGQLMNAASAVTSGFVFGGQLAFVSSVES-NAVLAFILSKIAGGIVAMLIAILL 350 Negativibacillus massiliensis
CDA61298     285 SVSMFSVFGKMDRRGQLMNAAAAVTSGFVFGGQLAFVSSVNN-DAVLAFILSKLLAGVLSIFIAILL 350 Clostridium sp. CAG:169
CDD58272     285 SLAMLPLFSKMDKRGKVLNAAFSVAGAYVVGGQMTFVASLIPgNWVTAYMISKVLSGGLAVALAVIc 351 Clostridium sp. CAG:43
WP_025435104 285 SLSMLPLFSQMDRRGKAMNAAFTVSGAYMLGGQLAFIGSVESiDVVSIYMVSKLVGGVCALIAAALf 351 Peptoclostridium acidaminoph...
Q8XI93       286 NIILFQSFNKMSSKGRIALTAFSVSGAFVIGGQLGFVSLKTP-EIINIYIASKLIAGITAMVLALIV 351 Clostridium perfringens
WP_010076946 286 NLLIFGTYKEMNPKGKIICTAFSVSGAFVFGGQFGFVSGIAP-KMIGAFILSKLVAGITSIVLANWL 351 Clostridium cellulovorans
CDE05356     303 NMAMFATMSKMKEKEKILNTAFAVCAAFIIGDHLAFTAANAP-SCIAPMMLAKAISGVTAVAIAALf 368 Anaerotruncus sp. CAG:390
Q4K5E5       320 ILAMFRLVRFMPPKDKVVNIAFGVCAAFLLGDHLSFTANFQP-TIILPVLIGKISAGFVAVGLAYWL 385 Pseudomonas protegens Pf-5
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap