Conserved Protein Domain Family
DUF485

?
pfam04341: DUF485 
Protein of unknown function, DUF485
This family includes several putative integral membrane proteins.
Statistics
?
PSSM-Id: 398163
Aligned: 246 rows
Threshold Bit Score: 53.2381
Threshold Setting Gi: 491458834
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q0K1J8          11 RRHPRFGELVRRRARLSRALLALVLAPFLALMLAVAMQPQRLAERLHPEtLFNLGIVLAIGIMLLGWGATWFYVRRANGE 90  Cupriavidus n...
jgi:Desti_2338  56 ARNPKFIELHRRKTVFLFGWWIFSTIYYFLLPIGAGSAPGFFSVKVI-G-NINIGYLFALSQFFVSWGIAMYYASWANKV 133 Desulfomonile...
Q39QH4          12 ANHPRFVELHRKKMVFLYGWWAFSAGFYFLLLLGAGYTPGFFGLEII-G-NINVGYLLALAQFVVSFGIAIHYGRVADRD 89  Geobacter met...
ACH38442        12 ASHPKFVELHQAKMRFLVGLWVFGATSYFLLLVGAISFPDLFNARIM-G-RLNFGYLFCLFQFVLAWAIAIIYTRKSNRE 89  Geobacter bem...
WP_012645276    12 ANMPKFIELHSRKKSFLLTLWCIGSILFYLLPICAGYAPDFMKVKLL-G-RLNVTYFFCLFEFIMTWAIAIIYTHRSNTY 89  Geobacter dal...
Q0SCT3          11 PQNSDLQVLADTRAALTFRLSALVLALFLPLPILGGFT-SLLDGVVFSG--VTVAWLYAVAQFVVAIVVARYYMARAAE- 86  Rhodococcus j...
WP_008408773    15 ASQQSFRQLARKKNSFLWSITAIFLVLYMLLPILTSFT-EILHQKAI-G-DITWVWLYSAGLFIMTWGLAHFYVARANK- 90  Solibacillus
WP_008408769    21 DRMETFNQFVKKKNTFLFGITITFLTFYLLLPIL-AFT-SVLQQKAV-G-NITWVWVYSLALFIMTIILCTLYVKMASK- 95  Solibacillus
Q9RX39          12 arPAAYRELVRQRNSFTVAMTLTFLVLYFLLPLLAGYNKPLMATKVF-G-NVTFGYVLAFLEFLMGWVMAAIYVRKART- 88  Deinococcus r...
Q1IXH8          13 vRNAAYQQLVAERNRFTVIMTVIFLVLYFLLPILAGYDKPLMATKVW-G-NVTFGYVFAFAEFVMGWVMAAIYVVRARQ- 89  Deinococcus g...
Q0K1J8          91 LEAMVQQIL 99  Cupriavidus necator H16
jgi:Desti_2338 134 SDRLTKELL 142 Desulfomonile tiedjei DSM 6799
Q39QH4          90 FDRLTQELV 98  Geobacter metallireducens GS-15
ACH38442        90 FDPLTTELV 98  Geobacter bemidjiensis Bem
WP_012645276    90 FDPLTKEVL 98  Geobacter daltonii
Q0SCT3          87 LDSRTASra 95  Rhodococcus jostii RHA1
WP_008408773    91 YDAEARAII 99  Solibacillus
WP_008408769    96 FDKAAAAVL 104 Solibacillus
Q9RX39          89 FDRLALEaq 97  Deinococcus radiodurans
Q1IXH8          90 FDRLAQEAQ 98  Deinococcus geothermalis DSM 11300
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap