Conserved Protein Domain Family
FemAB_like

?
pfam04339: FemAB_like 
Peptidogalycan biosysnthesis/recognition
FemAB_like is a family of both baterial and Viridiplantae proteins with responsibility for building interpeptide bridges in peptidoglycan. Such a function is feasible for bacteria but less likely for the plant members of this family. Perhaps the plant-members are using homologous proteins to recognize bacterial peptidoglcans as part of their innate immune system.
Statistics
?
PSSM-Id: 398162
Aligned: 71 rows
Threshold Bit Score: 502.041
Threshold Setting Gi: 152029896
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q1QKK7          13 SVSQITAVDWDACanpATkqhrslasdeapasssaqdSclsareqynPFVSHAFFTALEASNSACPRTGWRPRHLIARLD 92  Nitrobacter h...
Q2JP10          12 DIREIPAGAWHAL---QTe------------------Rt-------sPFLEYEWLHSLESSGCASRRTGWLPCHLLVEAD 63  Synechococcus...
Q31P02          12 RLGDLPREDWNAI---AQp------------------La-------tPFLEWDWLHDLEASGSVIAKAGWQPCHLVVWRG 63  Synechococcus...
Q7VE88          12 SIKEIPREKWAHL---VNk------------------Kv-------lPFYDWNWLNALEESESVSSRYGWQPLHLSLWEN 63  Prochlorococc...
Q8DHT3          19 AIASVPQNQWDAL---ALp------------------Le-------tPFFEWEWLHQIEASGSATPQTGWLPHHLLVWRD 70  Synechococcus...
AHJ31251        16 KIAEVPQNAWDAL---AMp------------------Lk-------tPFLEWDWLNNLEISQSATAKTGWLPNHLTLWRD 67  Nodularia spu...
Q10W29          16 KIAEVPKPEWDAL---AQp------------------Lk-------tPFLEWDWLHNMEKSGSVGGRSGWLPQHLTVWRD 67  Trichodesmium...
P74568          16 ALAEIPQPQWDRL---AVp------------------Lq-------tPFLEWHWLNNLETSGSAVRNTGWQPCHLTVWQG 67  Synechocystis...
wustl:cce_3020  16 kISEIPKQVWDEL---ATp------------------Lk-------tPFLEWEWLNNIETSKSATPRTGWQPCHLTLWRD 67  Crocosphaera ...
Q7NE42          13 SLQSIDPHEWNTL---VG-------------------Dg-------sPFLEWEWLRSMELAGCVSPGEGWQPVHLVARRG 63  Gloeobacter v...
Q1QKK7          93 G----AVVGVVPCYLKSHSQGEYVFDHGWAQAYESAGGRYYPKLLASVPFTPATGPRLLIRagsDKARvGAALVGGLVGL 168 Nitrobacter h...
Q2JP10          64 G----QLVAAAPLYLKSHSQGEFVFDQEWAAVAGQLGERYYPKLIGMAPFTPATGYRILVHpeySEAEvWSLMLAAIDRF 139 Synechococcus...
Q31P02          64 D----RLVAAAPLYLKGHSYGEFVFDQQWADLAGRLGLRYYPKLLGMTPLTPAVGYRFLIApaeDEATlTGLMLREIDRF 139 Synechococcus...
Q7VE88          64 N----RLISLAPLYLKNHSYGEFIFDQAFANLSNRLSVPYYPKLIGMSPLSPIEGYKFFISsekDSREiTEVMMKIIDEF 139 Prochlorococc...
Q8DHT3          71 RqgqrELVAAAPLYVKGHSQGEFVFDHQWADLAARLGIRYYPKLLGMAPFTPAVGYRFLMVegvDVAMmTKVMLHEIDRL 150 Synechococcus...
AHJ31251        68 R----TLIAVAPLYLKGHSYGEFVFDHQWAELADRIGVQYYPKLLGMTPFTPAEGYRFLIApgeDEDEiTALMVHEIDAF 143 Nodularia spu...
Q10W29          68 R----QLIAAAPLYLKGHSQGEFVFDHQWAEISYRLGIEYYPKLLGMSPFTPAEGYRFLIAsgeDEDEiTAMMVSEIDYF 143 Trichodesmium...
P74568          68 E----TLLGAAALYLKGHSYGEFVFDHQWADLAQRLGIDYYPKLLGMAPFTPAEGYRFLIDpeaNESLvTQIMVEAIDHF 143 Synechocystis...
wustl:cce_3020  68 K----QLIAVAPLYIKGHSYGEFVFDHQWADLSHRLGIPYYPKLLGMTPFTPAVGYRFLITpneNEAEiTEIMVAAIDHF 143 Crocosphaera ...
Q7NE42          64 G----RLVGAAPLYLKGHSYGEFVFDHAWADAAGRMGLRYYPKLMGVTPFTPAAGYRFLMHpgeEPGAlMSGITQAIDTF 139 Gloeobacter v...
Q1QKK7         169 CDATQASSVHVTFARQEEWTFLAGNGFLQRTDQQFHWRNEGYSSFEDFLANLASRHRKAIRRERRDALANGITIHVLTGN 248 Nitrobacter h...
Q2JP10         140 CQEKDISVFSLLYVDLDWRTQLESDGFTPRITHNYQWHNPGYRSYEDFLSQFNANQRRNIKRERAAMEKSGLELKIYTGE 219 Synechococcus...
Q31P02         140 CDNNQILSCNFLYVDPDWQPLVEAAGYSAWQHHNSVWQNRGFRTFDDYLGMFNANQRRNIKREVKSMERAGLTLTCLSGD 219 Synechococcus...
Q7VE88         140 AINNNISSCNFLYVDPSWKKHGESANCSSWINKQTLWSSHGEQSFEDYLARFNSNQRRNIKKERQSITKTDLRISIINGE 219 Prochlorococc...
Q8DHT3         151 CQRHRFSSCHFLYVDPQWQPAAEAYGYRAWLHHSYIWQNRNYQTFDDYLADFNANQRRNIKRERKAVAQAGLTFRVHQGD 230 Synechococcus...
AHJ31251       144 CIKHRISGCHFLYVDPQWRTVLERQGFTTWLHHSYIWENVGFKTFDDYLKLFNANQRRNIKRERKAVEKVGLRLQPLTGD 223 Nodularia spu...
Q10W29         144 CDRHNISGCHFLYVDPEWHPIIKRNGFTNWLHHSYIWQNQGYQTFDDYLKVFNANQRRNIKRERKAVGKAGLQMQTLTGD 223 Trichodesmium...
P74568         144 CQTNQISGCNFLFVDRQWQKQMESLGFTSWLHHSYIWQNQNFQDFDDYLQIFNANQRRNIKRERKAVQKAGLRIQVLQGN 223 Synechocystis...
wustl:cce_3020 144 CDQNKLSGCHFLFVDPDWKPMIENCGFSSWLHHSYIWSNPNFNNFDDYLKQFNANQRRNIKRERKAVNKANLTMKVLTGD 223 Crocosphaera ...
Q7NE42         140 ARNNRILSASFLYVAPRERERFQAQDCLERITHNYQWVNGGYRDFDEYLQRFNANQRRNIRRERAALEREGLTFTTYTGD 219 Gloeobacter v...
Q1QKK7         249 ELTEETWDAFFQFYMETGSRK--WG-RPYLTRSFYSLIGES-MSRDIALIMA--R---RDGRW-IAGAINFIGSDTLFGR 318 Nitrobacter h...
Q2JP10         220 EITPRLLSLMYDFYSNTCAQF--WNwSKYLNRRFFESLYPN-YRERVVLVAG--E---RNAEI-VGMSFCIRKGDRLFGR 290 Synechococcus...
Q31P02         220 QIPRDYFPLMYRFYSDHCDKFgwWG-SKYLTRDFFDRAMHH-SRHRLLFVAAtp---eGSDRP-IAMSFCVHKGDRLYGR 293 Synechococcus...
Q7VE88         220 EINLAMMEMMHNFYEAHCSRWgaWG-SKYLTKAFFERLANKdLANNIVLFNA--Nr--GNPKEpIAMSFCITDYQTLWGR 294 Prochlorococc...
Q8DHT3         231 EVSRSLLQRMHDFYADTCDKFgwWG-SKYLTRQFFEALSDR-YRHRVVLFAAypN---SGGQRpIAMSFCITKGTNLYGR 305 Synechococcus...
AHJ31251       224 AIPQSLFPLMYEFYADTCDKFgwWG-SKYLTKQFFEQLHTN-YRHRVVFFPAytE---QDERQpVGMSFCLFKGDRLYGR 298 Nodularia spu...
Q10W29         224 EISKALCSKMYNFYESTCDKFgwWG-SKYLTRRFFEQLHHN-FRHRVLFVAGysE---ENDRFpVGMSFCITKGDRLYGR 298 Trichodesmium...
P74568         224 QIPHHFFPAIYRFYSNTCDKFy-WG-SKYLTKKFFQSLYED-YRARVVLVLAfpE---HDDQHpVGLSFCLRKGDRLYGR 297 Synechocystis...
wustl:cce_3020 224 EIPHHLYPMIYRFYNNTCEKFy-WG-SKYLTRKFFEQLYPH-YSHRVVLAAA--YtdyDDHKP-VGLSFCIRKDDNLYGR 297 Crocosphaera ...
Q7NE42         220 SIRADLFGLMYRLYDDTCSKFm-WS-SKYLNRRFFQLIAEC-FAHRTVFIAA--H---KQADI-LAMSFNIRKGNHLYGR 290 Gloeobacter v...
Q1QKK7         319 HWGAIEHHPFLHFEVCYYQAIDFAIRHRLKTVEAGAQGEHKIARGYLPQTTYSAHYIADPALRRAVGDYLKHERHYVAEA 398 Nitrobacter h...
Q2JP10         291 YWGCREEVKFLHFNVCYYEPIALAIREGIRNFDPGAGGSHKIRRGFPATPVYSYHRFYSRRLQQVLVPYLNRVNPLMLAE 370 Synechococcus...
Q31P02         294 YWGCDHEIDNLHFNVCYYKPIEWAIANGIQSFDPGAGGSHKKRRGFPATPNWSLHRWYQPRFGQILGTWLRQVNELESQE 373 Synechococcus...
Q7VE88         295 YWGSKEEIKNLHFELCYYSPISWAIKNGIKEFDPGAGGNQKMRRGFTATPRFSLHRWYDNTMAQIIKDWLPKANNMMKEE 374 Prochlorococc...
Q8DHT3         306 YWGCAREIDCLHFSACYYEPIEWAIAHGIQRFDPGAGGRHKKRRGFPATPNYSLHRFYEPRLAEIFDHYIDQINDEEQRL 385 Synechococcus...
AHJ31251       299 YWGSFQEIDCLHFDACYYTPIEWAIAHNIQSFDPGAGGRHKKRRGFPAMPNYSLHRFYNSRLEQIIPPYIREVNQLEQQE 378 Nodularia spu...
Q10W29         299 YWGSNYEIDCLHFDACYYTPIEWAIQNGIKSFDPGAGGRHKKRRGFPATPNHSMHRFYHNRLSKIFLSYIGQVNEMEQLE 378 Trichodesmium...
P74568         298 YWGSLADYDCLHFEACYYQPIQWAIGENIQLFDPGAGGRHKRRRGFPATANYSLHRFYHPKMQQILQIYIDEINAMEQAE 377 Synechocystis...
wustl:cce_3020 298 YWGSFEEYDCLHFEACYYQPIEWAIKEGIKMFDPGAGGRHKRRRGFPATPNYSLHRFYDQKMTQILRNYIPQINEMEQEE 377 Crocosphaera ...
Q7NE42         291 YWGCTEEVKFLHFSTCYYQPVEAAIEMGLKVFDPGAGGQFKMRRGFAATPNYSLHRIYHPRFRQILEDHLKQANRATLEG 370 Gloeobacter v...
Q1QKK7         399 ARELT-DAGPFRK 410 Nitrobacter hamburgensis X14
Q2JP10         371 LENVNqNEVPFRE 383 Synechococcus sp. JA-2-3B'a(2-13)
Q31P02         374 IEAIN-AELPFSR 385 Synechococcus elongatus PCC 7942
Q7VE88         375 INASN-NEVPFIH 386 Prochlorococcus marinus
Q8DHT3         386 IDTIN-ADLPMKS 397 Synechococcus elongatus
AHJ31251       379 MAAIN-QDLPFNL 390 Nodularia spumigena CCY9414
Q10W29         379 MERIN-EDLPFIQ 390 Trichodesmium erythraeum IMS101
P74568         378 IDAIN-QDLPFSR 389 Synechocystis sp. PCC 6803
wustl:cce_3020 378 IDAIN-QDLPFSK 389 Crocosphaera subtropica ATCC 51142
Q7NE42         371 IDDLN-NDLPMKE 382 Gloeobacter violaceus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap