Conserved Protein Domain Family
DUF452

?
pfam04301: DUF452 
Protein of unknown function (DUF452)
Statistics
?
PSSM-Id: 113085
View PSSM: pfam04301
Aligned: 2 rows
Threshold Bit Score: 457.524
Threshold Setting Gi: 81784975
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9CJT9   1 MKTQHISQQGDNLIVYFAGWGTPPSVVEHLILPENYDLCLCYDYRDLHCDVDFSAYQHIRVVAWSMGVWVAERVMQGYPL 80  Pasteurella multocida
Q9K0T9   1 METKFYNHQGGHLILYFAGWGTPPDAVNHLILPENHDLLICYDYQDLNLDFDFSAYRHIRLVAWSMGVWAAERALQGIRL 80  Neisseria meningitidi...
Q9CJT9  81 LSATAINGTGLPCDDQYGIPEAIFAGTLSGLNEDNRTKFERRICGSKTLLRDYQHYSMRPtLQEIHAELTALYTFLQQDR 160 Pasteurella multocida
Q9K0T9  81 KSATAVNGTGLPCDDNFGIPCTVFKGTLENLTENTRLKFERRMCGDKASFEDYQQFPARP-FGEIHQELIALFAMIGQDR 159 Neisseria meningitidi...
Q9CJT9 161 RTDLISWSKAIVGSKDKIFPAQNQRAYWQDRCAITEIAGEHLLFPHFTHWETC 213 Pasteurella multocida
Q9K0T9 160 RTDLIRWTNALVGSGDKIFMPANQHRYWTPRCTVREIDVGHYLFSRFTHWSAL 212 Neisseria meningitidis serogroup B
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap