Conserved Protein Domain Family
Zn_peptidase_2

?
pfam04298: Zn_peptidase_2 
Putative neutral zinc metallopeptidase
Zinc metallopeptidase zinc binding regions have been predicted in some family members by a pattern match (Prosite:PS00142), of the characteristic HEXXH motif.
Statistics
?
PSSM-Id: 398130
Aligned: 315 rows
Threshold Bit Score: 197.618
Threshold Setting Gi: 503425716
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CDB27372                10 ITAMLFCTLFSAIASGKVHSAFSKYSKVRCRS--GKTGYDTVAQLLWSNRVNGISVGRVKgNLSDHYDPRRGVVNLSEST 87  Oscil...
WP_015488316             4 ILAFVLVLIVVVGPSQWVKWVLKRYSAERADF--PGTGGDMARHLITRLELGGVQVEETE-GG-DHYDPSSKTVRLTKDK 79  Thala...
WP_012639600             4 IVLIALVVLVLFLPSWWAGAVLRRHSVERQDY--PGTGGEFARHLLDRYGMGHVKVEVTD-RG-DHYDPRDKAVRLSPAY 79  Thioa...
PRJNA210423:M911_12810   3 FLALTLLLALFFLPAFIARSVLRHYSDEREDF--PGTGGELARHLLDRRGLNDVIVEVTE-AG-DHYDPQARAVRLSPQN 78  Ectot...
jgi:Nit79A3_3262         4 LVLVIAMTALIVAPSYWVKHTLKKYSYPEDRY--PGTGGELARILLDWANLQAVKVEVTE-QG-DHYDPLEKAVRLTPDK 79  Nitro...
jgi:Hhal_0175            4 ILLLVLLLGAVYGPGLWVQRVMRRYAEPGNRY--PVTGGQLARELLDGCGLNRIRVERTE-RG-DHYDPQAGAVRLSAEH 79  Halor...
Q0A7M5                   5 IILAVVVLAVLYLPGLWVRHVMAKYSTPADRY--PGTGAELARHLLRRAQLDEVAVEMTD-PGADHYDPEARAVRLSPDN 81  Alkal...
WP_012982310             5 ILLAPLVLLLAWAPSWWVRQTMKKYSQPEDRY--DGTGAELARDLLDRHGLQDVRVESTR-DG-DHYDAFDRAVRLSEDN 80  uncla...
AGA33081                 9 IILVPLLILATYGPGWWVRRTLAKYSQPEERY--QGSGGELARHLLNQRGLHKVAVEVTE-SG-DHYDPEARAVRLTSGN 84  Thioa...
WP_013345306             4 IIILLIITLGVFLPGMWVKHVMEKYGQPADRYrkQGSGGELARHLLDSHGLGDVLVEETA-VG-DHYDPTAKAVRLTPTN 81  Ferri...
CDB27372                88 YGNSSVASVAVAAHEMGHVMQKQEGYWFYRFRTALVSVVNFGSRLAFPLVLIG-LLL--DAfvisadpemgfhIAMIGVI 164 Oscil...
WP_015488316            80 LDGRSLTAVVVAAHEVGHALQDHLGEASFKLRSGLAVFSYIFQKIAPAALIAApLLAvwNpai-------srwAFMAAIG 152 Thala...
WP_012639600            80 LDGRSLTAVTVAAHEVGHAIQDHKGYGPLAWRSRLVGMAQGAEKLGAGLMMFApVLLlaTRapag-----gliMFLAGMM 154 Thioa...
PRJNA210423:M911_12810  79 HDGRSLTAVTVAAHEVGHALQHAEGYAPLQIRSTLARSAQQAERIGAWVMMLVpVMAvlTRspvg-----agfVLLVGVV 153 Ectot...
jgi:Nit79A3_3262        80 FNGKSLTAITVAAHEVGHAIQDRDGYLPLRLRTRLIQIAAPAEKLGAAILMMApVITviTRapva-----galFFAGGLL 154 Nitro...
jgi:Hhal_0175           80 YDRRSLAALTVAAHEVGHALQHTAGYGPFVWRQRLVRAVGRAQQLGAVLLLAApVVAgvLRvpgv-----aalFLLGGVL 154 Halor...
Q0A7M5                  82 YRGRSLTAVTVAAHEVGHALQHASGYPPFKARGHLVRLAAGGQRLGAIMMFAIpVVTllVRmpap-----gllLFLAGML 156 Alkal...
WP_012982310            81 HDGRSLTAITVAAHEVGHAVQHAQEYPPLRMRSNLVCLSRYGQQIGAWLMVAIpVITliARhpap-----gilFFLAGIL 155 uncla...
AGA33081                85 YHGRSLTAVTVAAHEVGHAIQHAEGYAPLRLRGELVRWAASGQRLGAFLMLAIpVITilTRhpap-----gamFLLAGLL 159 Thioa...
WP_013345306            82 YSGYSLTAVTVAAHEVGHAIQDSRGESLFLARQKLVKAAMAGERLAGIMLMATpIILllTRlpqa-----galTIVIGVV 156 Ferri...
CDB27372               165 LYGTSFLFTLVTLPVEINAS-RRAGKMLLQeGILT-TDEMPGAKKVLSAAALTYLASLMTSLVYFLRFFLY 233 Oscillibacter ...
WP_015488316           153 SMLVSTLVSLVTLPVEWNASfGKALPILQSgDYLSd-DDMRGARRILFAAAMTYVAGSLISLLSVGAWLRM 222 Thalassolituus...
WP_012639600           155 SFGAAALVHLVTLPVELDASyRRAMPILASg-YLPk-QDLAPARRILTACAFTYVAASLASMLNLWRWLAI 223 Thioalkalivibr...
PRJNA210423:M911_12810 154 SFGVSALVHLVTLPVELDASyRRAMPILAMg-YIPp-RDQRAARRILTACAFTYVATALASVLNMWRWLAL 222 Ectothiorhodos...
jgi:Nit79A3_3262       155 TLGTATVVHLVTLPMEMHASfARALPMLEHgKYLIq-GDEPHARKILRAAAWTYVSASLMTLLNIGRWWAI 224 Nitrosomonas s...
jgi:Hhal_0175          155 SLGSGVVVHLVTLPTELDASfRRALPLLRRsGYLYpDVDPPHARRILSAAALTYVAQSLASLLNFWTWLRV 225 Halorhodospira...
Q0A7M5                 157 SMGLAAVVHLVTLPTEWDASfGRALPMLERgRYLKp-VDYPHARRILTAAALTYVAQSLMSLLNIWAWLRM 226 Alkalilimnicol...
WP_012982310           156 SMGLAALVHFVTLPTEFDASfRRALPMLRRgNYLHp-PDYPHAQRILKAAAYTYLAQSLMSLLNIASWFRF 225 unclassified T...
AGA33081               160 SMGLAAIVHLVTLPTELDASfNRALPILRDgGYLYe-TDYPHAQRILKAAAYTYVAQSLMSLLNIWAWLRF 229 Thioalkalivibr...
WP_013345306           157 SMALSTLVHLITLPVEFDASyGKALPLLEKgEYLHd-GDLKHAEKILKAAALTYVAASLTSLLNLGRWVAV 226 Ferrimonas bal...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap