6U7L


Conserved Protein Domain Family
GD_AH_C

?
pfam04295: GD_AH_C 
Click on image for an interactive view with Cn3D
D-galactarate dehydratase / Altronate hydrolase, C-terminus
Family members include the C termini of D-galactarate dehydratase (EC:4.2.1.42) which is thought to catalyze the reaction D-galactarate = 5-keto-4-deoxy-D-glucarate + H2O, and altronate hydrolase (altronic acid hydratase, EC:4.2.1.7), which catalyzes D-altronate = 2-keto-2-deoxygluconate + H2O. As purified, both enzymes are catalytically inactive in the absence of added Fe2+, Mn2+, and beta-mercaptoethanol. Synergistic activation of altronate hydrolase activity is seen in the presence of both iron and manganese ions, suggesting that the enzyme may have two ion binding sites. Mn2+ appears to be part of the enzyme active centre, but the function of the single bound Fe2+ ion is unknown. The hydratase has no Fe-S core.
Statistics
?
PSSM-Id: 398128
Aligned: 260 rows
Threshold Bit Score: 391.377
Threshold Setting Gi: 503109384
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6U7L_B        122 TFEGYRNADGSVGTKNLLGITTSVHCVAGVVDYVVKIierdllpkypnvxGVVGLNHLYGCGVAInaPAAVVPIRTIHNI 201 Escherichia co...
jgi:Cmaq_1140  10 TIKAYIRPDGSVGVRNHVAIIPIDDLSNTAALGVAKLi-----------rGTVAIPHPYGRLQFG--RDLNLLFHVLSGT 76  Caldivirga maq...
WP_012021073    3 TIKGYIRENGAVGVRNHVLVLPLDDLSNSAALGVSKIv-----------nGVVAVPHPYGRLQFG--RDLDLLFHILSGT 69  Metallosphaera...
jgi:Mrub_2462  11 QLTGYRRPNGAVGVRNHVLILPVDDLSNAAAEGVARLi-----------hGTTALPHPYGRLQFG--ADLELTFRTLSGH 77  Meiothermus ru...
WP_015752742    5 kVLGYRRENGRVGVRNHVAILALDDLSNAACEAVENNv-----------kGTLALPHAYGRLQFG--EDLLLTFRTLIGL 71  Desulfohalobiu...
WP_012329712   42 TFMGWRRENGRVGVRNHVVLLPLDDLSNAACEAVANNv-----------kGTMALPHAYGRLQFG--EDLDLHFRTLIGI 108 Methylobacteri...
jgi:Dshi_2038   9 TVKGYRRENGRVGVRNHVLILPVDDISNAACEAVANNv-----------kGTLAIPHAYGRLQFG--EDLELHFRTMIGT 75  Dinoroseobacte...
WP_012613121    5 TFLGYRRENGRVGVRNHVVILPLDDLSNAASEAVANNv-----------kGTMALPHPYGRLQFG--EDLELHFRTLIGV 71  Desulfovibrio ...
CAL63441        7 TFLGYRRENGRVGVRNHVIILPLDDLSNAACEAVANNi-----------kGTMAIPHPYGRLQFG--ADLDLHFRTLIGT 73  Herminiimonas ...
Q1QWP0          7 TFLGYRRDNGRVGIRNHVIVLPVDDISNAAAEAVANNi-----------kGTLALPHPYGRLQFG--ADLDLHFRTLIGT 73  Chromohalobact...
6U7L_B        202 SLNPNFGGeVXVIGLgcEKLQPERLLTGtddvqaipvesasIVSLQDEkhvgfQSXVEDILQIAERHLQKLNQRQRETCP 281 Escherichia co...
jgi:Cmaq_1140  77 GANPNVYG-AIVIGI--EDNWANKVADViaktg----kpvyVFSIEGNg---dLKTIEAAARKAKELVQDAGEQQRTEVD 146 Caldivirga maq...
WP_012021073   70 GANPNVAG-VIVIGI--EDNWANRVADGiaktg----kpveVFPIEGYg---dLKTIERASRKAKEMVQEASEKQRTEVD 139 Metallosphaera...
jgi:Mrub_2462  78 GANPNVHG-VVVIGI--EPKWTDRVASAiaktg----kpveTFSIERHg---dLNVINAASRVAYRMAQDASELRREPIQ 147 Meiothermus ru...
WP_015752742   72 GSNPNVAA-CVVIGI--EPEWTQKVVDGiaatg----kpveGFSIERNg---dFNTINMASKKAKEYVHYASEIKPEEVD 141 Desulfohalobiu...
WP_012329712  109 GSNPNVAA-VVVIGI--EDQWTNRVVEGiartg----kpvvGFGIEGHg---dIAIVAKASYQAKRFVQWATELQREECP 178 Methylobacteri...
jgi:Dshi_2038  76 GANPNVHS-VVVIGI--EPGWTKRIADGiretg----kevaEFSIEQKg---dFETIRAASWAAKDFVHKATEMQREECS 145 Dinoroseobacte...
WP_012613121   72 GSNPNVAA-VVVIGI--EPQWTNRIVEGiaktg----kpvaGFSIEQNg---dHNTICNASRKAKEFMHWATELQRVECP 141 Desulfovibrio ...
CAL63441       74 GSNPNVAA-VVVIGI--EDSWTKKIVDGiaatg----kpvvGFGIEGHg---dHETIMNASKKAREFMQWASEKKREECH 143 Herminiimonas ...
Q1QWP0         74 GCNPNVAA-VIVIGI--EPGWTGKVVDGiratg----kpveGFWIEQNg---dHNTIANASRKAREFVQYASELQREPCD 143 Chromohalobact...
6U7L_B        282 ASELVVGXQCGGSDAFSGVTANPAVGYASDLLVRCGATVXFSEVTEVRDAIHLLTPRAVNEEVGKRLLEEXEWY-DNYLN 360 Escherichia co...
jgi:Cmaq_1140 147 LTGIVFSIKCGESDTTSGLASNPALGHTVDKLVDLGNTVMFGETSELTGAEDIVASRIKDPELRSKFMRIYNEYv-EVIE 225 Caldivirga maq...
WP_012021073  140 ISSIVMSVKCGESDTTSGLASNPSVGVVVDKMVDLGAVAMFGETSELTGAEDIVADKMANEALREKFLKIYREYi-DVIE 218 Metallosphaera...
jgi:Mrub_2462 148 VSELVLSIKCGESDPTLGLAGNKAQGRAVDRLVDMGASVIFGETSELTGGEHLIANRCATPALKRKFMQIYNDYi-RMIE 226 Meiothermus ru...
WP_015752742  142 SSEIWISVKCGESDTTSGLASNPTVGNVLDKHIEKGGTAVFGETSEITGAEMVCKERAATPEVGEAFYKMFKDYn-EFIN 220 Desulfohalobiu...
WP_012329712  179 IADLWVSTKCGESDTTTGLASCPTVGNMYDKLIPHGIYGVFGETSEITGAEHLCRERAISPEVSDKWYAMWKAYqDDVIE 258 Methylobacteri...
jgi:Dshi_2038 146 ISELWVSTKCGESDTTTGLGSCPTVGNMYDKLLPEGITGFFGETSEITGAEHICQKRAINEEVGQRWYKMWKAYqDDVIF 225 Dinoroseobacte...
WP_012613121  142 VSDLWVSTKCGESDTTSGIASNPTVGNAFDKLYEQGCTLLFGETTELTGGEHLVLERCANDEVRKQFQFFFDRYa-KLVD 220 Desulfovibrio ...
CAL63441      144 IKELWVSTKCGESDTTSGCGANPTVGAAFDKLHALGSTLVFGETSEITGGESILAARCANDEVRKQFMFMFDRYq-DMIN 222 Herminiimonas ...
Q1QWP0        144 VSELWVSTKCGESDTTSGCGANPTVGEAFDKLYEQGCTLVFGETSELTGGEHLVAARCANDDVRERFQAMFDRYs-AMID 222 Chromohalobact...
6U7L_B        361 XGKT-DRSA-NPSPGNKKGGLANVVEKALGSIAKSG-KSAIVEVLSPGQ--RPTKR-GLIYAATPASDFVCGTQQVASGI 434 Escherichia co...
jgi:Cmaq_1140 226 REGV-DLLGsQPTEGNIKGGLSTIEEKALGNIQKLG-TRPITCVADYLDp-VPR-NgGLCFVNTSSAAAEAVTLFAAKGS 301 Caldivirga maq...
WP_012021073  219 REGA-DLLGsQPTQGNIKGGLSTIEEKALGNIQKLG-HRKVNCVLDYLDplVREKQgTLCFVNTSSAAAEAVTLFAAKGS 296 Metallosphaera...
jgi:Mrub_2462 227 AQGV-DLLGsQPTEGNIRGGLSTIEEKALGNIQKTG-TRPIQAVLDYAEpvKP--GqGLVFMNSSSAGAEQVTLCAAGGS 302 Meiothermus ru...
WP_015752742  221 ENKTdDLSGsQPTKGNIRGGLTTIEEKAFGNLQKIGkKCQYVGVLEPAE--APT-GkGLWFMDSSSAAAEMVTLCAAAGF 297 Desulfohalobiu...
WP_012329712  259 AHKTdDLSDsQPTKGNIAGGLTTIEEKALGNLEKIGhECRFIDALQPAE--APTKGpGLYFMDTSSAAAECVTLMAAAGY 336 Methylobacteri...
jgi:Dshi_2038 226 AHQTdDLSDsQPTKGNIEGGLTTIEEKALGNLEKIGrTSQFIDILEPAE--QPKSGnGLYFMDSSSAAAECVTLMAAGGA 303 Dinoroseobacte...
WP_012613121  221 DHKTsDLSDsQPTKGNIEGGLTTIEEKALGNIQKIGrKAPVVGCLDKAE--APT-GpGLWFMDSSSAAAEMVTLCAAAGF 297 Desulfovibrio ...
CAL63441      223 RHKTsDLSDsQPTKGNIAGGLTTIEEKAMGNIQKIGkKCTVDGVIDKAE--MPT-HsGLWFMDSSSAAAEMVTLCAASGF 299 Herminiimonas ...
Q1QWP0        223 RHKTsDLSEsQPTKGNIEGGLTTIEEKALGNIQKIGkRCRVDGVLDKAE--TPT-GpGLWFMDSSSAAAEMVTLCAASGY 299 Chromohalobact...
6U7L_B        435 TVQVFTTGRGTPYGLXAvPVIKXATRTELANRWFDLXDINAGTIAtGEETIEEVGWKLFHFILDVASGKkKTFSDQWGlH 514 Escherichia co...
jgi:Cmaq_1140 302 VLHFFTTGQGNVVGHPIiPVIKISANPKTVKAMGEHIDVDVSDLLeLKVSLQEAGDRIFNYALRVMNGR-LTAAEALQ-H 379 Caldivirga maq...
WP_012021073  297 VLHLFTTGQGNIVGHPLiPVIKITGNPKTARTMSEHIDVDVSDLLdLKISLEEAGERVFNYMLRVMNGR-LTAAEVLH-H 374 Metallosphaera...
jgi:Mrub_2462 303 VLHFFTTGQGNIVGHPLiPVIKVSPNPITCSTMSEHIDVKLPDLLvGDINLDQAADRILEVFARTVNGR-LTAAELLR-H 380 Meiothermus ru...
WP_015752742  298 VVHLFPTGQGNIIGNPVePVIKLSANPLTCSTMSEHIDYDCSGILrGEMTLDESGDGLVDLVKRTCGGR-KTSAEVLG-H 375 Desulfohalobiu...
WP_012329712  337 VVHTFPTGQGNVIGNPIvPVIKITGNPRTVRTMGEHIDVDVSGVLtREMTIPQAGDALIDMVVRTANGR-LTAAESLG-H 414 Methylobacteri...
jgi:Dshi_2038 304 VIHTFPTGQGNVVGNPIvPVIKITANPRTVRTMAEHVDVDVSGILrREMTIDEAGDALIEMICRTANGR-NTAAEALG-H 381 Dinoroseobacte...
WP_012613121  298 VVHLFPTGQGNVIGNPIlPVVKLCANPRTVRTMSEHIDVDVSGILrKELTMDGAGDKLVEMAIRTANGR-NTAAEVLG-H 375 Desulfovibrio ...
CAL63441      300 VVHFFPTGQGNVIGNPIlPVIKICANPRTVRLMSEHIDLDCSGLLqRELTLEQTGDKLLEMMISTANGR-LTDAEVLG-H 377 Herminiimonas ...
Q1QWP0        300 VAHFFPTGQGNVIGNPIlPVIKLCANPRTVRTMSEHIDVDVSGVLrREINLQEAGDQLLEMLLRTANGR-HTNAEALG-H 377 Chromohalobact...
6U7L_B        515 NQLAVFNPAPV 525 Escherichia coli K-12
jgi:Cmaq_1140 380 DEFSPIKLYVS 390 Caldivirga maquilingensis IC-167
WP_012021073  375 EEFSPIKLYIS 385 Metallosphaera sedula
jgi:Mrub_2462 381 NEFVITKLYPS 391 Meiothermus ruber DSM 1279
WP_015752742  376 KELIITKLYRs 386 Desulfohalobium retbaense
WP_012329712  415 REFVMTKLYRs 425 Methylobacterium radiotolerans
jgi:Dshi_2038 382 REFSMTKLYRs 392 Dinoroseobacter shibae DFL 12 = DSM 16493
WP_012613121  376 REFVLTRLYEs 386 Desulfovibrio vulgaris
CAL63441      378 REFVLTRLYEs 388 Herminiimonas arsenicoxydans
Q1QWP0        378 REFVLTRLYEs 388 Chromohalobacter salexigens DSM 3043
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap