Conserved Protein Domain Family
SpoVR

?
pfam04293: SpoVR 
SpoVR like protein
Bacillus subtilis stage V sporulation protein R is involved in spore cortex formation. Little is known about cortex biosynthesis, except that it depends on several sigma E controlled genes, including spoVR.
Statistics
?
PSSM-Id: 398126
Aligned: 108 rows
Threshold Bit Score: 523.984
Threshold Setting Gi: 504010148
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q1QZ68          11 DWNFEILTAYEREIARFAKEYRLNTYPNQIEIITSEQMMDAYASVGMPVGYHHWSFGKQFLSVEQAYRRGQMGLAYELVI 90  Chromohalobac...
WP_012634935     3 DFSLKELEYWNERIEQIAVDSGLNFYNQEFEIINYEDMIGYESYVGMPSHYPHWSYGKSYERIKTLHKYNLTGLPYEMVI 82  Ruminiclostri...
jgi:Cthe_1203    3 EYSMKELIEWNEKIEEIARAEGLDYYEQEFEICSYEDMIAYETYVGMPSHYPHWSYGKNYERIKTLYKYNLTGLPYEMVI 82  Hungateiclost...
WP_013484665     2 aYTLDDLENWNEKIEALSRTAGLDYYPQEFELVDYNEMIGYEAYTGMPSRYPHWSFGKSYEKIKTLYRYNLSGLPYEMVI 81  Ethanoligenen...
jgi:Clopa_4104   2 EYTVADLEAWNKKIEKIVNDIGLDYYEQEFETIGYKDMLGYEAYLGMPSRYPHWSFGKAYEKNSTTYKYNLSGLPYEMVI 81  Clostridium p...
CDM67318         2 DYTVKDLEMWNDRIEEVVRSVNLDYYPQEFEIIGYKEMIGYEAYVGMPSRYPHWSFGKAYEKNRTLYRYNLTGLPYEMVI 81  Clostridium b...
WP_010076704     2 EYSVKDLETWNAKIEKLVHEFGLKCYDQEFQLISYNDMIALEAYTAMPARYPHWSFGKSYEKTKTLYKYNLTGLPYEMVI 81  Clostridium c...
Q8XKR2           2 DYNLKDLEGWNNKIEEIAKSEGLDYYPQEYEIIGYNEMLSYEAYVGMPSKYPHWSYGKAYEKNKTLYSLNMTGLPYEMVI 81  Clostridium p...
WP_022749632     2 EYSFSDIEKWNEKIEKKVKEYGLDFYPQEFEVIGFNDMIGYEAYVGMPSRYPHWSFGKSYEKNKTLYSLNLTGLPYEMVI 81  Clostridium s...
WP_013624316     2 qYTLAEIESWNERIEEIARSLGLDYYPQEFELVNYEDMLSYEAYIGMPSRYPHWSFGKSYEKLKTLYQYNLSGLPYEMVI 81  Syntrophobotu...
Q1QZ68          91 NSDPCIAYLMEENTLMMQVLVMAHAcYGHNSFFKGNYLFRTWTDASAIVDYLVFARKYIAECEE--RHGVGAVEQLLDAC 168 Chromohalobac...
WP_012634935    83 NSNPCIAYLMKDNSLLVQILTIAHV-YAHNDFFKNNRLFKQGTKAEYSVETFKNHANRIRDYISdpSIGYAKVEKILNAA 161 Ruminiclostri...
jgi:Cthe_1203   83 NSDPCIAYLMKDNTLLLQILTMAHV-YGHNDFFKNNRLFKLGTRAKDTVDMFKNHADRIREYIQdpGIGYAKVEKILNAA 161 Hungateiclost...
WP_013484665    82 NSDPCIAYLIRDNTLLLQILTMAHV-YGHNDFFKNNRLFKEGTDASRTLESFRSHAAMIRSYINdpGIGYAKVEEMLNAA 160 Ethanoligenen...
jgi:Clopa_4104  82 NSDPCIAYLMKENTLLLQILTMAHV-YGHNDFFKNNRLFAEGTRADYTVELFKTDADMVRGYINdpSIGYE-------TA 153 Clostridium p...
CDM67318        82 NSNPCLAYLMRENTLLLQILTMAHV-YGHNDFFKNNRLFKEGTDANRTIEMFKVHADTIRDYINdpSIGYENVERVLDAA 160 Clostridium b...
WP_010076704    82 NTDPCIAYLMKDNTLLLQILTIAHV-YGHNDFFANNRLFVEGTDASTTTEMFKLHGDRVRSYINdpSIGYAEVERILDAA 160 Clostridium c...
Q8XKR2          82 NSNPCLAYLMKDNTLLLQILTMAHV-YGHNDFFKNNRLFKEGTDANNALEMFKLDADTIRGYINdpSIGYSQVERILDSA 160 Clostridium p...
WP_022749632    82 NSDPCLAYLMKDNTLLLQILTMAHV-YGHNDFFKNNRLFKQGTNASYTLEMFNLDAKIIRDYIDdpSIGYSEVERILDAA 160 Clostridium s...
WP_013624316    82 NSDPCIAYLMKDNTLLLQILTMAHV-YGHNDFFKNNRLFQAETRPELTLEMFKSHARMIKSLINdpSIGYEKAEKILDAA 160 Syntrophobotu...
Q1QZ68         169 HALQNYgVDRYKRPsPISSEEEARRQQEREAYLqaqvnalwrtipeQATPTAQRPDEdgddpl-----glhqhgRYPAEP 243 Chromohalobac...
WP_012634935   162 HAVKLQ-TERIIDF-RNKIEEKNKSKSALA----------------ENKSDFPNLEKysqnekkddteagrqeiKIPEEP 223 Ruminiclostri...
jgi:Cthe_1203  162 HAIRYQ-ISRNIG--VRVLSQEEKKKELLERYN-------------KPKSEYPLLEPkskeee-----appdfkKIPVEP 220 Hungateiclost...
WP_013484665   161 HSVKLQ-IGRTAG--EKRKSDAERRQERIDQYN-------------RRSESRSLLEPhtpal-------ppeleKIPLEP 217 Ethanoligenen...
jgi:Clopa_4104 154 HAIKLQ-TSRVVG--EKRISDEALKSRIMQEYV-------------NKNTNKSILEPyvkdt-------ppnisKIPLEP 210 Clostridium p...
CDM67318       161 HSLKLQ-TSRAVG--EKRIDEEEIKKRIMDNYL-------------EKTGSYSILDGykeip-------apdiyKIPLSP 217 Clostridium b...
WP_010076704   161 HALKLQ-TSRVVG--EKRVSEQKLRQRLIDDYE-------------NKVEGTDFFGKrndvp-------vpnidKIPIEP 217 Clostridium c...
Q8XKR2         161 HSIRYQ-VPRVIG--EKRESQDEQRKRVLEIFN-------------KKKENRGILDSmeeil-------ppdisKIPLNP 217 Clostridium p...
WP_022749632   161 HAIRYQ-IGRTVG--IKELSNEEIKENMIKDYE-------------RKKGNRGILDSnkkie-------lpdleKIPLEP 217 Clostridium s...
WP_013624316   161 HALKLQ-TSRAVG--VKRLSPEEQKTALLEEYH-------------RKMSGQSILEPyreee-------ppdlsKIPLQP 217 Syntrophobotu...
Q1QZ68         244 QENLLYFLEKNAPlLESWQREVVRIVRKLAQYFYPQRQTQVMNEGWATFWHYTLMNRLydegLIDEGTILEFLHSHTAVI 323 Chromohalobac...
WP_012634935   224 QEDILNFITEYGR-LQDWEKDILSIVREEAQYFIPQIETKIMNEGWASFWHYTILTKL----ELPQSLHFEFLRKHNEVI 298 Ruminiclostri...
jgi:Cthe_1203  221 EEDMLLFFMNYSK-LTDWERDILSIVREETLYFLPQIETKIMNEGWASFWHYNILNKL----NLEQGLHFEFLKRHNQVI 295 Hungateiclost...
WP_013484665   218 EDDLLAFIMAHGD-LEDWQQTILGAVREEAAYFLPQIETKILNEGWASYWHYTTLGRL----DLPPALHLEFIKRHNDVV 292 Ethanoligenen...
jgi:Clopa_4104 211 EDDVLYFIIRYGN-LSEWEKNLLQVVRKETAYFIPQIETKIMNEGWASYWHYNILKRL----NLPDKLHLEFLKRHNDVI 285 Clostridium p...
CDM67318       218 EDDLLYFIIKHGD-LAEWEKNILSIVRDETLYFIPQIETKIMNEGWASYWHYTILKNL----ELPTGLHLEFIKRHNDVI 292 Clostridium b...
WP_010076704   218 EEDLLYFIIKYGK-LAEWEKTLLEIVRQETNYFLPQIETKIMNEGWASYWHYTILNAL----DLPSGLHLEFLKRHNDVI 292 Clostridium c...
Q8XKR2         218 DDDIIQFIIDYSN-LEEWEKNILKIVRRESLYFLPQIETKIMNEGWASYWHYNILKKL----NLPQGLHLEFLKRHNDVV 292 Clostridium p...
WP_022749632   218 VDDVIGFIIEYGN-LQEWEKTILRIVKRETQYFIPQIETKIMNEGWASYTHYNILKEL----DLPQELHFEFIKRHNDVI 292 Clostridium s...
WP_013624316   218 EEDLLLFIRQYGE-LEEWETNILEIVRSETRYFIPQIETKIINEGWASYWHYEILKAL----DLPSELHLEFIKRHNDVI 292 Syntrophobotu...
Q1QZ68         324 qqpgfdSPHFNGINPYALGFAMFSDIRRICeaptdedrewfpdiagsDWldTLHFAMRNFKDESFIQQFLSPRVIRDLKL 403 Chromohalobac...
WP_012634935   299 ------RPLKSSINPYYIGFKIIENLYNTQg----------------KD--KIFEVRENERDQSFIRRYLTQELCGEMNL 354 Ruminiclostri...
jgi:Cthe_1203  296 ------RPVLGQLNPYYIGFRIFEDLKKRYe----------------DDpkKIFEVREVERDQSFIRRYLTRELCEEMNL 353 Hungateiclost...
WP_013484665   293 ------RPIPGGLNPYFLGFEMLRDIAARYg----------------EE--KIFEVRALERDASFIRKYLTRELCEKLHL 348 Ethanoligenen...
jgi:Clopa_4104 286 ------APGIGFINPYFIGFKMFEYLHEKYg----------------KE--KIFEIRKLERDESFIRRYLTKELCYDLNL 341 Clostridium p...
CDM67318       293 ------APIVGGLNPYFLGFKIFEYLDKTYg----------------RE--KIFEVRECDRDSSFLRRYLTEELCAEFNL 348 Clostridium b...
WP_010076704   293 ------APALGGVNPYYVGFKIFEYLDKTYg----------------RD--KIFEVRTMDRDSAFLRRYLTEDLCRELNL 348 Clostridium c...
Q8XKR2         293 ------APVSYGLNPYYIGFRIFQDIEKRYg----------------RE--KIFEVRALERDNSFIRKYLTRELCEELNL 348 Clostridium p...
WP_022749632   293 ------APAIGGLNPYYIGFKIFEDLDKKYg----------------KE--KIFEVREVERDSSFLRRYLTKELCEELNL 348 Clostridium s...
WP_013624316   293 ------APASGRLNPYYLGFTLFQELCKAHg----------------RE--KIFEVRAYERDESFLRRYLTRELCAKLHL 348 Syntrophobotu...
Q1QZ68         404 FSLVDDDRDEMltISAIHDERGYRRVREALSAQYALSLRePNIQVWEADIRG 455 Chromohalobacter salexigens DSM 3043
WP_012634935   355 FEYIAAGNDYM--ISEVSDEEGWKQVRDTLCNTVGIGSI-PTIKVIEWSPKE 403 Ruminiclostridium cellulolyticum
jgi:Cthe_1203  354 FEYAKIGNSYI--VTEVSDEEGWKKIRDTIANNVGLAGI-PVIKVAEWVQKd 402 Hungateiclostridium thermocellum ATCC 27405
WP_013484665   349 FKYAKQASDYF--VEEIADEAGWKKIRDTLADTTGMGTV-PYIRVIEMSRRd 397 Ethanoligenens harbinense
jgi:Clopa_4104 342 FEYAKENENYV--IKDVPDEKGWINIRNTLCSSCGMGMI-PYIRIIDMSTRD 390 Clostridium pasteurianum BC1
CDM67318       349 FEYVRKSGDIY--VKEVADESGWKEIRNSLASNCGMGSV-PYIRVYDMNLKD 397 Clostridium bornimense
WP_010076704   349 FEYKKTGNDYV--IKEVSDEEGWKEIRNNLSSSCGLGSV-PIIRVVDMSKKd 397 Clostridium cellulovorans
Q8XKR2         349 FQYVKKGFDYV--VEEVSDDLGWKSIRNLIADECGVSSI-PHIRVRELNKKd 397 Clostridium perfringens
WP_022749632   349 FQYNKRTFDTV--IEEISDETGWKTIRDTLSYTAGMGSI-PYVRVIDLNKKd 397 Clostridium saccharobutylicum
WP_013624316   349 FEYTAEGNDYF--VENVPDEEGWQSVRDTLCQSAGMGGV-PLIRVADLSgkd 397 Syntrophobotulus glycolicus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap