Conserved Protein Domain Family
DUF446

?
pfam04287: DUF446 
tRNA pseudouridine synthase C
This family is suggested to be the catalytic domain of tRNA pseudouridine synthase C by association. The structure has been solved for one member, as Structure 2HGK, which by inference is designated in this way.
Statistics
?
PSSM-Id: 398123
Aligned: 76 rows
Threshold Bit Score: 99.9069
Threshold Setting Gi: 488373001
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CBV41681              6 ELDSALRELESTMRAANLWRLERPEPAAFDSAQPFCVDTMSLPQWLRFVFIARLDELVAAEGPMPASCDVAPAVEA---Y 82  Halomona...
WP_011523585          9 ECAEAVDKIEAEMKRIGYWQEAPLREEQYGFQQAFAMDTMTYAQWLQFAFLPRVREAITSQQF-PKSSDVGTQAIR---E 84  Candidat...
CASKLGSI:MRBBS_1462  13 QVADRLLAIEIQLRQMNCWQSEPLAAEKYLSREPFCLDTMSFEQWLQFVLLARLKQLVEDDQPLPMVSGVAPMAEE---H 89  Marinoba...
WP_012488014          8 ALAEILMDVEKELRELRLWECDALPEAALLSQQPFAIDTMSFPQWLQFIFLPRMYTLVEQQLPLPGNCGIAPMAEQ---Y 84  Cellvibr...
UNSW:PCNPT3_09525    11 QLALLLTSLECELKALDLWEASKPSEHLLNSELPFCIDTLSFPQWLQFVFIEKMKIILNMAMPLPQTISVAPMATE---Y 87  Psychrom...
Q47Y02                9 HISTLLADLAFELKSLNLWQIPQPSAAELSSNAPFCCDTLAFGQWLQFIFIPKITMMIHQQQSLPTKISLTPMAEE---A 85  Colwelli...
Q15QZ7               13 QVEKLLSQLAEALKTAEQWTYSPPSQWAMQSELPFACDRMGFAQWLQFIFIPKMNELLQEEKPLPTRMALMPMAQEwakE 92  Pseudoal...
CASKLGSI:C427_1669    9 EVEILILKLEQSLREAMLWSSFAPSVEALQSKLPFALDTMLFEQWLQFVFIPKMTEIVNTQGILPQNMHLLPMAEQ---C 85  Paraglac...
jgi:Shew_2644         4 yTEKQLRLIEAELKRLQLWQDQPPSAEAMADPTPFACESMTFEQWLQFIFLPKMGEIIAVNGALPSQIALTPMAEH---V 80  Shewanel...
BAJ01194              4 KTTQKLEELEAELKRRSLWSPQAPSVEAMADTSPFSCESMAFENWVQFIFLPKMRALIADRQVLPSNIAVAPMAHH---V 80  Shewanel...
CBV41681             83 LTQEGArnSDRILMgKAVERIDT 105 Halomonas elongata DSM 2581
WP_011523585         85 FDGDIN---ASGLV-TRLCDFDA 103 Candidatus Koribacter versatilis
CASKLGSI:MRBBS_1462  90 YRSGSG--PGQALI-RELAALDE 109 Marinobacter sp. BSs20148
WP_012488014         85 FAPLSL--NTSPLI-DHLQQIDR 104 Cellvibrio japonicus
UNSW:PCNPT3_09525    88 FTLQQL--PSSPLI-ILLEQIDT 107 Psychromonas sp. CNPT3
Q47Y02               86 FTHLST--SAKPLI-DVIQKIDK 105 Colwellia psychrerythraea 34H
Q15QZ7               93 YTTGQP--TREPVL-DVLAQIDL 112 Pseudoalteromonas atlantica T6c
CASKLGSI:C427_1669   86 FGAADN---QSAHM-QVIKQIDL 104 Paraglaciecola psychrophila 170
jgi:Shew_2644        81 WQGRAE---MRVLI-TIINQLDE 99  Shewanella loihica PV-4
BAJ01194             81 WNDIKE---RHTLI-NIFDELDK 99  Shewanella violacea DSS12
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap