Conserved Protein Domain Family
DUF441

?
pfam04284: DUF441 
Protein of unknown function (DUF441)
Predicted to be an integral membrane protein.
Statistics
?
PSSM-Id: 398120
Aligned: 88 rows
Threshold Bit Score: 100.181
Threshold Setting Gi: 269969697
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q2RJR6           5 LIILAVLVVAVLGRANTVALAASLLLVLKLLQ-VDQYiFPFIEKGGTFWGLVLLIAAILVPLARGTVTLRDLGHVFL--S 81  Moorella ther...
CDI40794        10 LIILVILILGVLSKNNSLALAATVILGLKLIN-LKQV-LIFIDKNALKWGIIILTMGIIAPFATGKITIKDVNGALK--N 85  Tepidanaeroba...
JLU:CLAU_3018    5 IILVIILAAAVLGKANSVALAACILLFLKLLN-IDKYvFPTLQENGIFWGVVILVASILIPIANGSVKYISIRNVFT--S 81  Clostridium a...
Q97MU9           5 IILVVILGISIVGKATSVAISVAALLILKLLG-LDKYiFPYLNDKGMFWGLVLLTAAILIPIAQGNVKAIDIKNNLV--S 81  Clostridium a...
jgi:Clopa_4685   5 IILVIILAISIIGKANSVSVATAILLIIKLLN-IEKYiFPALDKSGVFWALVLLIAAILIPIANGSISPFKIKDNLT--S 81  Clostridium p...
WP_009171721     5 IILLVILAASILGKANSVAIATSILLIIKLVN-LDKYiFPVIEDSGMTLGLILLIAAILIPIADGKYTAINIKNVLA--S 81  Clostridium s...
WP_013495231     6 LVLLAILGLGALGRNPLVTAAAGILLLLRLMG-LASW-LPLLEQHAMSLGLVLLIVAVLIPFADGQVTVQQTVQSFTrgG 83  Thermaerobact...
A0PY40           5 IILLILMFLSFISKNKSLGIATIVMLFISFFN-TEKC-ITFMENHFMNLGMTFLMIWMLIPIIKNPEFTENIKNAF---N 79  Clostridium n...
C0Z7G8           6 IILLVIALLSLVAKDLVLVYASLLLLGLSLLK-AVPV-MDAIQKPMFHVGLFCLMVFLLIPIAKGKYDFISLGKEMV--S 81  Brevibacillus...
jgi:Toce_2241    5 sIIFLILALGYLGKNRLILVSSGVLLLFSYLGlLPKS--TEAQNIMLDLGVILLVMGILLPLSTGEVYAKDVYRSIF--T 80  Thermosedimin...
Q2RJR6          82 WVGLSAFILSLITTYMSGQGLQYLTVQghSEVMPALILGAVIAAAFLGGVPVGPFITSGVLALLV 146 Moorella thermoacetica ATCC ...
CDI40794        86 PSALAALLAGALTVILSGKGTNLIAES--PQVVVGIILGSLIGIAFFKGVPVGPLTAAGIVAVIM 148 Tepidanaerobacter acetatoxyd...
JLU:CLAU_3018   82 WLGIFALLISLFTTYLSGLGMQYLTVQghTEVMPALILGAVIAAAFLGGVPVGPMITSGMIALgl 146 Clostridium autoethanogenum ...
Q97MU9          82 FVGITALVLSFLTTYLSGVGLRYLTVQghSDVMPSLILGSVAAAAFLGGVPVGPLITSGILALLV 146 Clostridium acetobutylicum A...
jgi:Clopa_4685  82 VIGIIALLLSFFTTYLSGLGLKYLTVQghGDVMPALILGSIAAAAFLGGVPVGPLITTGLLALVM 146 Clostridium pasteurianum BC1
WP_009171721    82 WIGIAALIISLFTTYLSGLGLQYLTVQghGDVMPALILGAVIASAFLGGVPVGPLITSGMLALgv 146 Clostridium sp. DL-VIII
WP_013495231    84 LAGYAGLVAGFVAAVLGARGIVLLEQN--PHVIIGLIFGTLVGVAFFQGIPVGPLTAAGFAAVLL 146 Thermaerobacter marianensis
A0PY40          80 LKGIVCFLCGAIVAVLASKGVGFLKGS--TDTLTGIILGSIVGVSLLGGVPVGPLIASGIAYEVV 142 Clostridium novyi NT
C0Z7G8          82 WKATIAILAGFIISYVGGKGLSILPDQ--PVVFIGVTIGTLLAVLLSNGLPAGLIIAAGCIALLs 144 Brevibacillus brevis NBRC 10...
jgi:Toce_2241   81 LEGLVIFLVGIASAVMARDGVDLLKEN--PGIMICLLMGSIVGTAFFKGLPTGPLVAAGLAAFII 143 Thermosediminibacter oceani ...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap