2FXT,2CW9


Conserved Protein Domain Family
Tim44

?
pfam04280: Tim44 
Click on image for an interactive view with Cn3D
Tim44-like domain
Tim44 is an essential component of the machinery that mediates the translocation of nuclear-encoded proteins across the mitochondrial inner membrane. Tim44 is thought to bind phospholipids of the mitochondrial inner membrane both by electrostatic interactions and by penetrating the polar head group region. This family includes the C-terminal region of Tim44 that has been shown to form a stable proteolytic fragment in yeast. This region is also found in a set of smaller bacterial proteins. The molecular function of the bacterial members of this family is unknown but transport seems likely. The crystal structure of the C terminal of Tim44 has revealed a large hydrophobic pocket which might play an important role in interacting with the acyl chains of lipid molecules in the mitochondrial membrane.
Statistics
?
PSSM-Id: 398116
Aligned: 70 rows
Threshold Bit Score: 108.861
Threshold Setting Gi: 124446043
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2FXT_A        38 SRVYSQFKLMDPTFSNESFTRHLREYIVPeILEAYVKGDVKVLKKWFSEAPFNVYAAQQKIF-KEQDVYADGRILDIRGV 116 baker's yeast
Q69V11       316 AVSFREIRQRDPSFSLPDFAGDVQEMIKP-VLTAYSKGDVKTLKKYCTKEVIERCKGERDAY-ASQGIFFDHKILHISDA 393 Japanese rice
Q1PF33       316 ASTYKEIRSRDPSFSLPDFAAEIEEVIKP-VLNAYSEGDVETLKKYCSKEVIERCTAERTAY-QTHGVLFDNKLLHISEV 393 thale cress
A0CBB5       243 ARAIKQMRMIDPDFDLYELEKEAKVIFEQ-IYNLYLLGDLESLQKVCGEAALGYFKVLLKKQeAEKSEPKHKQLWNVDEI 321 Paramecium tetr...
Q7Q8M7       245 SAALTEVCRIDPSFEAKQFLQFCERHVIPnVLESILRGELDVLRDWCFESAYSVIATPIVQG-LEAGCRFESKLLDIENV 323 Anopheles gambi...
2CW9_A        39 SEVLTEILRVDPAFDKDRFLKQCENDIIPnVLEAXISGELDILKDWCYEATYSQLAHPIQQA-KALGLQFHSRILDIDNV 117 human
XP_002640066 269 SEVLTEIHKIDANFDKQEWLKFCETKIIPnILEAFIRFDLEVLQSWCHERAFTQLSTVVKEYqKMHWSTKDSRIIDINKV 348 Caenorhabditis ...
Q16KX3       278 SETLTEICKIDPNFDQKQFLRDCENDIIPnILEAMIRGDLEVLKDWCFESTYNIIATPISQA-QKLGYYLDSKVLDIENV 356 yellow fever mo...
Q4N770       228 ASALREMKRLDPSFNLPDLVELVEHVIAPhVVESYLKGDGEALKLHCGEVAFNILNTSIKER-NLQKLVLDPSILILKNV 306 Theileria parva
EDO07177     237 AKAVKEMKRLDSSFDLPEFIESVEHVVAPhIVQCYLDGDSKSLEAHCGELAFNVLNASIRER-DLQKLYLDPNILILKDV 315 Babesia bovis
2FXT_A       117 EIVSAKLLapQDIPVLVVGCRAQEINLyRKKKT-GEIAAGDEANILMSSYAMVFTRDpe---qIDDDe-TEGWKILEF 189 baker's yeast
Q69V11       394 DVRETKMM--GSTPIIIVGFQTQQIYCvRDREG--QVTEGGQDTIQTVFYAWAMQLMdsdevpEEESy-YPVWRLREI 466 Japanese rice
Q1PF33       394 SVSVTKMM--GDSPIIIAKFQTQEIYC-VRDEN-GEIQEGGQDTIHTVYHEWAMQQVet--teLGEDaiYPIWRLREM 465 thale cress
A0CBB5       322 RFTRASIPdsVKLPVFIFTIKTQEIFCyVSKSDrSKIIDGDDERIMSMDYQFALTPHsn---pSSDEf-GHIWEMIEL 395 Paramecium tetrau...
Q7Q8M7       324 ELAMGQVM--EQGPVLIVTFQAQQIVCvREGTG-AAVIEGDPEKVFRCHHAWVLCRDp----sELNP--QAAWRIMQL 392 Anopheles gambiae...
2CW9_A       118 DLAXGKXV--EQGPVLIITFQAQLVXVvRNPKG--EVVEGDPDKVLRXLYVWALCRDq----dELNP--YAAWRLLDI 185 human
XP_002640066 349 EMATGKMM--EQGPVLIISFQVYMINVtKNAEG--KVVEGDPDNPKRINHIWVLCRDv----eEYNP--AIAWKLLEV 416 Caenorhabditis br...
Q16KX3       357 DLAMGKVM--EQGPVLIITFQTQQIMCvRDSKG--NVVEGDPEKVMRCNYVWVLCRDp----nDLNP--KSAWRLMEL 424 yellow fever mosq...
Q4N770       307 ELKGGMKVk-EGDPWLIFNFTTQQINClRDTKG--KVCAGQIDDIREVVYSIAISRHp----nPLETl-EYPYLVLNT 376 Theileria parva
EDO07177     316 ELKGGMTMe-EGYPWFIFNFKTQQINClRDSRG--HVVAGEIDDIRQVVYSMAVSRHpd---iSRDGl-EYPYMVHEV 386 Babesia bovis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap