Conserved Protein Domain Family
DUF443

?
pfam04276: DUF443 
Protein of unknown function (DUF443)
Family of uncharacterized proteins.
Statistics
?
PSSM-Id: 398112
Aligned: 15 rows
Threshold Bit Score: 184.802
Threshold Setting Gi: 81675063
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8ERH4  11 NLRYRILEINGEEYVLDF-GNSIW-KIIFPFLHWVLPNPVYKIDNHEIIEKLeVPQENHPKKISTGTGALGGlvgGVFLA 88  Oceanobacillus iheyensis
Q8ERG9  11 NPRYKILVINEQRYILDMgGKSFW-KILFPFMYWIFPNNTYKVNNLEIIEKIkTPDIDQKDVGGGMSILGGVv--AILLA 87  Oceanobacillus iheyensis
Q8ERI2  11 NLRYRILEIDEEEYILDM-GNSVW-KIIFPFLHWVLPNPVYKLDNHEIVKRLkVPEREQPKTISAGTGALGGl-iGVFLA 87  Oceanobacillus iheyensis
Q2G0H1  12 NPKYKVIQHNGEYLLVDL--VSTWfVYFFPFINWFIPKKYAIISEEEFEN---LNVVKPNKNNVF-WSVIGS---SVLFG 82  Staphylococcus aureus...
Q2G0G7  12 NPKYRIIKYNDEYLMVDI--ISTWiSLFFPFINWFIPKEYVKISREEFEN---LNIVKPAKKNVF-WPVAGS---SALLG 82  Staphylococcus aureus...
Q2G0H4  14 NPKYRIIKYDSEYLMIDL--ASNWiVFFFPFINWLIPKTYVKITKNDYEK---LNIVKPVKNKSIGWTIFAG---IVLLG 85  Staphylococcus aureus...
Q2G0H9  14 NPRYRIIKYKNDYLMIDL--VSTWlVLFFPFINWLIPKKYVQISREDFDN---LNIVKPVKNKAL-WPAIGS---ILLFG 84  Staphylococcus aureus...
Q8ELD8  11 NLRYNLIKADNEYYIIDK-DQPFLtNFLLPFLYWIFPKKVTKISG-DTAEQIqTVSNKEATTSKVSYIGIGF---SVILA 85  Oceanobacillus iheyensis
Q8ELD9  11 kaRYNLITMNGENYILDK-DSPKW-IIWLPFLFWFISHRAYKVDSEVTVNKL-VRHSEKTSGSTINILAIGI---SLILA 84  Oceanobacillus iheyensis
Q8ERG6  11 NLRYRILVINSHTYILDL-GKSFW-KIIFPFLIWILPNPLYKIENKEIVEKLkTPEVHQTNTGGQGLIGGGI---AVLIA 85  Oceanobacillus iheyensis
Q8ERH4  89 NLLRPLANVFNIPSTSLVNLIITIIVLIIALSVFVYVNRRHEKNLTAIVDYT-HYPRKKIWIKPPTLKFFFNICFAYLFF 167 Oceanobacillus iheyensis
Q8ERG9  88 NLLRPLANVFNIPSTPIVNAIIVLMVLLLVLILVFNISKRCKKRINHELDIE-QYEEEQVWIRPNSIKQLLFILFAYLFF 166 Oceanobacillus iheyensis
Q8ERI2  88 SLIRPLANMFHIPSTSLINFIITILVVIIALSVFIYINTRSKNNLTAIVDYK-HYPRKKLWIRPPSLKFFSSLCFFYLFF 166 Oceanobacillus iheyensis
Q2G0H1  83 VTLRKYIHVFDVQLDKLVVMILCALALICVIVFYFNLNRKLKLKVFDTN----IEKNKRVILIP-TFKLGCFLVFGYIFA 157 Staphylococcus aureus...
Q2G0G7  83 VALRKYTHLLDIQLDKKLVIAICCITFIGILIFYVRLIKKSSLNIYNT-----KNKRSKIFLIP-TLKNVCFTLFGYILF 156 Staphylococcus aureus...
Q2G0H4  86 GTVRRNTYLFDFQLEELIVWSSCFIGFLEIIFFYCYLNKKLTLNIYNES----KNNELKLRLLP-SFKNICFTIFYYLFT 160 Staphylococcus aureus...
Q2G0H9  85 TMFRDKIYIPDSHLEKNCVIIICSVLLLSILVFYIYLNQKVKLSIYND-----RSSNGKIMIFP-SFKNLCFVLFSYFFC 158 Staphylococcus aureus...
Q8ELD8  86 NLIGPLLDYLDVDITPFIAYSILFLITLLLVLFRVIVSNKFKHSLFQQLHLSpNQADETLWVTPRRVKNIASLLFLTIFI 165 Oceanobacillus iheyensis
Q8ELD9  85 NLIRPIMDSFNIDMSTFLATLIVLVVTVLMFLLRIYIGRNNQQKLYAQVSSE-LRNVKELHIKVKSMGYFLIYTGCYLFI 163 Oceanobacillus iheyensis
Q8ERG6  86 NLLRPLTDYFNIQSSTMVNSVIVIVAILLLLSLRLYINHLNKKNLYRVIEAE-KLTPDKVLISPKPIKHFFLILGMYLFF 164 Oceanobacillus iheyensis
Q8ERH4 168 MALTVVPLMGFI--ETGDMFIFVPGVVFLFVSFMITYMTIPpGNTTVRFK 215 Oceanobacillus iheyensis
Q8ERG9 167 LGFTTLALSGFI--YSGDVMTLVMGTPILLVLLAISIITIN-GDTIVRFK 213 Oceanobacillus iheyensis
Q8ERI2 167 MALTVVPLMGFI--ETGNIIIFFGSIFFLFVTFMINYFTILvGNTTVRFR 214 Oceanobacillus iheyensis
Q2G0H1 158 GSFSIFSLIALMtiEPQNIIIFIYWIMMTMLFFLLNMTSIGnEKVRVIMK 207 Staphylococcus aureus subsp. aureus NCTC 8325
Q2G0G7 157 GGLTMLFLDALLsmSYQNIIVYFVWIAVIMGFFLVNIALIIdKNIHVILK 206 Staphylococcus aureus subsp. aureus NCTC 8325
Q2G0H4 161 GFMSYGAFYLLVfeNVQNLILYVSWLFMTMLFMFMNMHSIIdKKVHIFLK 210 Staphylococcus aureus subsp. aureus NCTC 8325
Q2G0H9 159 GGLSIMFLDVLIslSIQNIIVFIAWVIMTMLFFFINMSSIIdKKIHV-IY 207 Staphylococcus aureus subsp. aureus NCTC 8325
Q8ELD8 166 WAFVVGGLVSFF--LYGNLFMLFVFTLAFFILLFLNILCVTpGKDTMKIR 213 Oceanobacillus iheyensis
Q8ELD9 164 LAFLIACAMMYI--IYGNTIILVVYTMLAFIFFMGNLFTVTpGQMEVRVK 211 Oceanobacillus iheyensis
Q8ERG6 165 LAFTILLFIAFI--QIPNILILLITMSLWFLVLFTNSITIAvGNTRVKFi 212 Oceanobacillus iheyensis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap